Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4U0W4W0

Protein Details
Accession A0A4U0W4W0   
Localization Confidence High
Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
84-106KERGYVHKPRRGKRTRTRSHSVABasic
130-160TTTSRSRSRRDQVQRTRRRVKKLKQSLRVPDHydrophilic
NLS Segment(s)
PositionSequence
91-99KPRRGKRTR
144-152RTRRRVKKL
Subcellular Location(s) nucl 17.5, cyto_nucl 12.5, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MATAAELPSLFTAIQSVPNARIDLHARQLSSADRKSLDHLVQLAERGPAAHFLDSVLNQSYRQTIHAWSRTRTRADDDDDLELKERGYVHKPRRGKRTRTRSHSVAASAEGDDEGDGDDDQEETTEQEDTTTSRSRSRRDQVQRTRRRVKKLKQSLRVPDIDLERPELPPDFPPSELFTALHARTSHLYEARHNLLAPLTLTPTTTATTTTTTSSATLPAPVRAHFDALRTRINAEEERAVRAGTRDVVTAWKRTRIQKANAGERRAIWTDASRAYEGSALVALGLLTQLLVKDAVSSEADLLPDLPPPPGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.16
3 0.18
4 0.19
5 0.22
6 0.23
7 0.21
8 0.24
9 0.25
10 0.27
11 0.33
12 0.33
13 0.31
14 0.31
15 0.33
16 0.35
17 0.39
18 0.37
19 0.32
20 0.31
21 0.32
22 0.35
23 0.4
24 0.35
25 0.3
26 0.29
27 0.28
28 0.27
29 0.27
30 0.24
31 0.17
32 0.16
33 0.14
34 0.12
35 0.14
36 0.15
37 0.14
38 0.13
39 0.13
40 0.16
41 0.16
42 0.18
43 0.16
44 0.15
45 0.15
46 0.16
47 0.18
48 0.16
49 0.17
50 0.16
51 0.19
52 0.27
53 0.34
54 0.38
55 0.39
56 0.46
57 0.5
58 0.52
59 0.5
60 0.47
61 0.45
62 0.46
63 0.48
64 0.42
65 0.4
66 0.38
67 0.36
68 0.31
69 0.26
70 0.2
71 0.16
72 0.15
73 0.14
74 0.2
75 0.29
76 0.35
77 0.44
78 0.52
79 0.58
80 0.68
81 0.75
82 0.78
83 0.8
84 0.83
85 0.85
86 0.85
87 0.85
88 0.78
89 0.72
90 0.65
91 0.56
92 0.45
93 0.36
94 0.29
95 0.21
96 0.17
97 0.13
98 0.09
99 0.07
100 0.06
101 0.05
102 0.04
103 0.04
104 0.04
105 0.04
106 0.04
107 0.04
108 0.04
109 0.04
110 0.04
111 0.05
112 0.05
113 0.05
114 0.05
115 0.06
116 0.06
117 0.1
118 0.13
119 0.14
120 0.2
121 0.24
122 0.27
123 0.36
124 0.41
125 0.48
126 0.54
127 0.64
128 0.68
129 0.76
130 0.82
131 0.84
132 0.88
133 0.84
134 0.84
135 0.83
136 0.81
137 0.81
138 0.83
139 0.83
140 0.81
141 0.83
142 0.8
143 0.75
144 0.67
145 0.57
146 0.49
147 0.42
148 0.35
149 0.28
150 0.23
151 0.19
152 0.17
153 0.17
154 0.15
155 0.13
156 0.12
157 0.16
158 0.14
159 0.14
160 0.16
161 0.17
162 0.18
163 0.18
164 0.17
165 0.14
166 0.17
167 0.17
168 0.18
169 0.15
170 0.16
171 0.16
172 0.18
173 0.19
174 0.17
175 0.18
176 0.18
177 0.23
178 0.24
179 0.24
180 0.21
181 0.2
182 0.17
183 0.16
184 0.14
185 0.1
186 0.09
187 0.08
188 0.08
189 0.09
190 0.1
191 0.1
192 0.09
193 0.1
194 0.09
195 0.11
196 0.12
197 0.13
198 0.12
199 0.12
200 0.13
201 0.12
202 0.13
203 0.11
204 0.14
205 0.14
206 0.17
207 0.18
208 0.18
209 0.22
210 0.21
211 0.24
212 0.2
213 0.23
214 0.25
215 0.27
216 0.3
217 0.26
218 0.26
219 0.25
220 0.29
221 0.27
222 0.24
223 0.27
224 0.25
225 0.27
226 0.26
227 0.24
228 0.21
229 0.2
230 0.2
231 0.16
232 0.16
233 0.13
234 0.13
235 0.21
236 0.23
237 0.3
238 0.3
239 0.35
240 0.39
241 0.46
242 0.56
243 0.57
244 0.62
245 0.62
246 0.69
247 0.72
248 0.74
249 0.71
250 0.62
251 0.55
252 0.54
253 0.48
254 0.4
255 0.31
256 0.27
257 0.28
258 0.29
259 0.31
260 0.26
261 0.24
262 0.23
263 0.23
264 0.2
265 0.16
266 0.12
267 0.08
268 0.07
269 0.07
270 0.06
271 0.05
272 0.04
273 0.03
274 0.03
275 0.04
276 0.04
277 0.05
278 0.05
279 0.05
280 0.06
281 0.07
282 0.1
283 0.1
284 0.11
285 0.12
286 0.13
287 0.14
288 0.13
289 0.13
290 0.11
291 0.13
292 0.13