Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4U0W0V5

Protein Details
Accession A0A4U0W0V5   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
8-31EAITPSRKAVPPRKAKGRKGGDIEHydrophilic
NLS Segment(s)
PositionSequence
14-27RKAVPPRKAKGRKG
Subcellular Location(s) nucl 14, mito 7, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR012312  Hemerythrin-like  
Pfam View protein in Pfam  
PF01814  Hemerythrin  
CDD cd12108  Hr-like  
Amino Acid Sequences MSKYSLAEAITPSRKAVPPRKAKGRKGGDIELPDYISPEPKNAAERRDWDRMSSRMEGFHTYFRASFKQLFELADGSFAKHGLSVKDFMGVAESFHEHLGFHHGIEEQHIFPVLAKRMPQFRDDHQEEHDAIHKGMDELQMLISRYRSDPTSYSPDDFRRNLASWGPLLFYHLDAEVETLKPEILRRYWTIGEVRRLPM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.41
3 0.48
4 0.5
5 0.56
6 0.66
7 0.75
8 0.8
9 0.84
10 0.86
11 0.85
12 0.83
13 0.79
14 0.75
15 0.7
16 0.64
17 0.57
18 0.48
19 0.4
20 0.32
21 0.26
22 0.21
23 0.19
24 0.15
25 0.15
26 0.16
27 0.17
28 0.24
29 0.26
30 0.29
31 0.3
32 0.36
33 0.4
34 0.46
35 0.45
36 0.42
37 0.44
38 0.43
39 0.43
40 0.41
41 0.36
42 0.3
43 0.31
44 0.31
45 0.28
46 0.28
47 0.24
48 0.22
49 0.22
50 0.22
51 0.22
52 0.21
53 0.23
54 0.21
55 0.23
56 0.23
57 0.22
58 0.21
59 0.2
60 0.16
61 0.15
62 0.14
63 0.11
64 0.1
65 0.1
66 0.08
67 0.08
68 0.1
69 0.08
70 0.09
71 0.11
72 0.1
73 0.12
74 0.12
75 0.1
76 0.11
77 0.1
78 0.08
79 0.08
80 0.08
81 0.08
82 0.08
83 0.08
84 0.06
85 0.06
86 0.11
87 0.1
88 0.1
89 0.1
90 0.11
91 0.11
92 0.12
93 0.14
94 0.09
95 0.09
96 0.09
97 0.08
98 0.08
99 0.12
100 0.12
101 0.11
102 0.12
103 0.15
104 0.21
105 0.22
106 0.25
107 0.24
108 0.27
109 0.36
110 0.38
111 0.38
112 0.34
113 0.36
114 0.33
115 0.31
116 0.32
117 0.23
118 0.2
119 0.18
120 0.16
121 0.13
122 0.14
123 0.14
124 0.09
125 0.08
126 0.09
127 0.11
128 0.11
129 0.12
130 0.11
131 0.11
132 0.12
133 0.13
134 0.14
135 0.15
136 0.16
137 0.21
138 0.28
139 0.3
140 0.31
141 0.34
142 0.38
143 0.42
144 0.41
145 0.38
146 0.36
147 0.34
148 0.35
149 0.32
150 0.3
151 0.25
152 0.24
153 0.22
154 0.17
155 0.18
156 0.16
157 0.14
158 0.13
159 0.12
160 0.11
161 0.1
162 0.12
163 0.11
164 0.11
165 0.11
166 0.1
167 0.1
168 0.11
169 0.14
170 0.18
171 0.19
172 0.24
173 0.26
174 0.32
175 0.33
176 0.37
177 0.42
178 0.44
179 0.49