Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4U0VYC1

Protein Details
Accession A0A4U0VYC1    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
5-25AAPEEPPKKKRRLPRLDDSFDBasic
NLS Segment(s)
PositionSequence
11-17PKKKRRL
Subcellular Location(s) nucl 21, cyto_nucl 13.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR027521  Usb1  
Gene Ontology GO:0005634  C:nucleus  
GO:0016829  F:lyase activity  
GO:0004518  F:nuclease activity  
GO:0034477  P:U6 snRNA 3'-end processing  
Pfam View protein in Pfam  
PF09749  HVSL  
Amino Acid Sequences MTSAAAPEEPPKKKRRLPRLDDSFDEPKRPTDSPELHQGRKRAAPHLRGQWASHVYLERK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.72
3 0.75
4 0.76
5 0.8
6 0.83
7 0.79
8 0.75
9 0.71
10 0.68
11 0.58
12 0.52
13 0.42
14 0.34
15 0.33
16 0.3
17 0.27
18 0.26
19 0.29
20 0.28
21 0.38
22 0.41
23 0.42
24 0.45
25 0.45
26 0.41
27 0.43
28 0.43
29 0.41
30 0.43
31 0.45
32 0.5
33 0.56
34 0.59
35 0.56
36 0.55
37 0.54
38 0.49
39 0.44
40 0.4