Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4U0W188

Protein Details
Accession A0A4U0W188   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
79-98GRVRSWTEFKQQRRREPGVFHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 22, E.R. 2, golg 2
Family & Domain DBs
Amino Acid Sequences MFQIILFLGSVPVLLRLRHALNSDTHVVAEGDDDVPLGWHVPPEQFAPDSSESESDGHVRTRLLGQHAQSQDYLESGHGRVRSWTEFKQQRRREPGVFRIS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.12
3 0.16
4 0.18
5 0.2
6 0.22
7 0.2
8 0.21
9 0.25
10 0.26
11 0.23
12 0.2
13 0.19
14 0.16
15 0.14
16 0.12
17 0.09
18 0.07
19 0.06
20 0.06
21 0.05
22 0.05
23 0.05
24 0.05
25 0.04
26 0.04
27 0.05
28 0.06
29 0.07
30 0.08
31 0.09
32 0.09
33 0.1
34 0.13
35 0.14
36 0.15
37 0.14
38 0.13
39 0.13
40 0.13
41 0.13
42 0.1
43 0.1
44 0.1
45 0.1
46 0.09
47 0.09
48 0.11
49 0.13
50 0.15
51 0.18
52 0.19
53 0.26
54 0.27
55 0.27
56 0.25
57 0.24
58 0.2
59 0.17
60 0.16
61 0.09
62 0.1
63 0.1
64 0.13
65 0.13
66 0.13
67 0.15
68 0.19
69 0.24
70 0.27
71 0.31
72 0.38
73 0.46
74 0.56
75 0.65
76 0.7
77 0.75
78 0.79
79 0.81
80 0.79
81 0.79