Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4U0VU68

Protein Details
Accession A0A4U0VU68    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
389-408QEQDRIRRGAKPPKTKARVGBasic
NLS Segment(s)
PositionSequence
395-405RRGAKPPKTKA
Subcellular Location(s) mito 10, cyto 9.5, cyto_nucl 8, nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR032442  CTU1_C  
IPR014729  Rossmann-like_a/b/a_fold  
IPR011063  TilS/TtcA_N  
Gene Ontology GO:0016740  F:transferase activity  
GO:0006400  P:tRNA modification  
Pfam View protein in Pfam  
PF01171  ATP_bind_3  
PF16503  zn-ribbon_14  
CDD cd01993  Alpha_ANH_like_II  
Amino Acid Sequences MAPCQLCPPEAPNRAILRRPKTLQPVCKDCFFLVFETEIHHTIMGYGQAEQLPDKASRARNGAGKGKEKEEAHNSDSHGSLSNGAGTGATPAAATATPRRKHLFKRGEKVAIGASGGKDSTVLAYVMKLLNERYDYGLDLCLLSIDEGISGYRDASLDTVKRNAEQYDMPLKILSYSELYGGWTMDKVVAEVGKKGNCTYCGVFRRQAIDRGANILDVDHIVTGHNADDVAETVLMNVLRGDMPRLQRCTAITTGQEASPSSSSTAASATTTSTGSCKRSAANEADYLEGEEEALDNLLPKTIKRSKPFKYVYEKEIVMYAYFKKLDYHSTECIYAPTAYRGYARALVKDLEAVRPSAIVDLIYSGEAMAASLSLRGRRAGGDLDPILQEQDRIRRGAKPPKTKARVGANATAGGGAGDDAGPKGQVQQSCSRCGLLTSQALCQACMLLEGLNKGVAKVELRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.58
3 0.62
4 0.6
5 0.62
6 0.65
7 0.66
8 0.69
9 0.73
10 0.74
11 0.74
12 0.77
13 0.71
14 0.71
15 0.65
16 0.55
17 0.49
18 0.42
19 0.34
20 0.27
21 0.25
22 0.21
23 0.21
24 0.24
25 0.21
26 0.2
27 0.18
28 0.15
29 0.14
30 0.15
31 0.14
32 0.11
33 0.11
34 0.12
35 0.13
36 0.14
37 0.14
38 0.14
39 0.14
40 0.15
41 0.16
42 0.21
43 0.25
44 0.29
45 0.33
46 0.36
47 0.4
48 0.45
49 0.51
50 0.52
51 0.56
52 0.55
53 0.53
54 0.55
55 0.51
56 0.52
57 0.52
58 0.51
59 0.45
60 0.45
61 0.44
62 0.4
63 0.38
64 0.32
65 0.26
66 0.2
67 0.19
68 0.15
69 0.14
70 0.12
71 0.11
72 0.1
73 0.08
74 0.09
75 0.07
76 0.06
77 0.05
78 0.05
79 0.06
80 0.06
81 0.08
82 0.16
83 0.25
84 0.27
85 0.33
86 0.38
87 0.43
88 0.51
89 0.6
90 0.63
91 0.63
92 0.71
93 0.74
94 0.74
95 0.68
96 0.62
97 0.52
98 0.42
99 0.33
100 0.25
101 0.17
102 0.12
103 0.12
104 0.1
105 0.08
106 0.08
107 0.07
108 0.07
109 0.07
110 0.06
111 0.06
112 0.09
113 0.09
114 0.1
115 0.1
116 0.1
117 0.12
118 0.13
119 0.14
120 0.14
121 0.14
122 0.15
123 0.14
124 0.15
125 0.12
126 0.11
127 0.1
128 0.07
129 0.07
130 0.06
131 0.05
132 0.04
133 0.04
134 0.04
135 0.04
136 0.05
137 0.05
138 0.05
139 0.05
140 0.05
141 0.05
142 0.06
143 0.09
144 0.11
145 0.13
146 0.16
147 0.16
148 0.18
149 0.19
150 0.19
151 0.18
152 0.17
153 0.2
154 0.24
155 0.24
156 0.23
157 0.21
158 0.21
159 0.19
160 0.18
161 0.14
162 0.08
163 0.08
164 0.09
165 0.08
166 0.09
167 0.09
168 0.08
169 0.08
170 0.06
171 0.06
172 0.06
173 0.06
174 0.06
175 0.06
176 0.08
177 0.08
178 0.1
179 0.13
180 0.13
181 0.14
182 0.15
183 0.16
184 0.16
185 0.19
186 0.18
187 0.23
188 0.26
189 0.29
190 0.31
191 0.3
192 0.33
193 0.32
194 0.36
195 0.31
196 0.3
197 0.27
198 0.27
199 0.25
200 0.21
201 0.19
202 0.13
203 0.1
204 0.07
205 0.07
206 0.04
207 0.04
208 0.04
209 0.04
210 0.04
211 0.04
212 0.04
213 0.04
214 0.04
215 0.04
216 0.04
217 0.05
218 0.04
219 0.04
220 0.04
221 0.05
222 0.05
223 0.05
224 0.04
225 0.04
226 0.05
227 0.05
228 0.07
229 0.1
230 0.15
231 0.19
232 0.22
233 0.22
234 0.24
235 0.24
236 0.26
237 0.24
238 0.21
239 0.17
240 0.17
241 0.18
242 0.16
243 0.16
244 0.13
245 0.13
246 0.11
247 0.11
248 0.09
249 0.09
250 0.09
251 0.09
252 0.09
253 0.07
254 0.07
255 0.07
256 0.06
257 0.07
258 0.07
259 0.07
260 0.09
261 0.11
262 0.13
263 0.14
264 0.15
265 0.15
266 0.18
267 0.22
268 0.24
269 0.24
270 0.24
271 0.24
272 0.24
273 0.22
274 0.2
275 0.16
276 0.12
277 0.09
278 0.06
279 0.05
280 0.04
281 0.04
282 0.03
283 0.04
284 0.04
285 0.06
286 0.06
287 0.06
288 0.15
289 0.24
290 0.31
291 0.38
292 0.47
293 0.51
294 0.62
295 0.67
296 0.66
297 0.68
298 0.66
299 0.63
300 0.6
301 0.54
302 0.44
303 0.4
304 0.33
305 0.23
306 0.2
307 0.17
308 0.15
309 0.15
310 0.15
311 0.15
312 0.16
313 0.21
314 0.25
315 0.29
316 0.29
317 0.3
318 0.31
319 0.29
320 0.29
321 0.25
322 0.2
323 0.16
324 0.16
325 0.15
326 0.14
327 0.15
328 0.16
329 0.16
330 0.22
331 0.22
332 0.2
333 0.22
334 0.22
335 0.21
336 0.24
337 0.23
338 0.2
339 0.2
340 0.19
341 0.17
342 0.16
343 0.16
344 0.12
345 0.11
346 0.07
347 0.06
348 0.07
349 0.07
350 0.07
351 0.06
352 0.05
353 0.05
354 0.05
355 0.05
356 0.04
357 0.03
358 0.03
359 0.06
360 0.07
361 0.09
362 0.1
363 0.11
364 0.12
365 0.13
366 0.16
367 0.16
368 0.16
369 0.21
370 0.2
371 0.21
372 0.21
373 0.2
374 0.19
375 0.17
376 0.17
377 0.15
378 0.23
379 0.24
380 0.26
381 0.28
382 0.34
383 0.43
384 0.51
385 0.58
386 0.6
387 0.68
388 0.76
389 0.81
390 0.78
391 0.78
392 0.77
393 0.76
394 0.71
395 0.68
396 0.59
397 0.54
398 0.49
399 0.4
400 0.3
401 0.2
402 0.15
403 0.08
404 0.05
405 0.04
406 0.05
407 0.05
408 0.06
409 0.06
410 0.06
411 0.11
412 0.15
413 0.18
414 0.23
415 0.32
416 0.35
417 0.41
418 0.42
419 0.39
420 0.35
421 0.34
422 0.32
423 0.29
424 0.32
425 0.29
426 0.3
427 0.34
428 0.34
429 0.33
430 0.29
431 0.23
432 0.16
433 0.15
434 0.13
435 0.1
436 0.11
437 0.13
438 0.13
439 0.16
440 0.16
441 0.15
442 0.16
443 0.17