Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2LPU4

Protein Details
Accession E2LPU4    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
22-48VSSYINPGLRWRRRKRRPSSSSFTKAIHydrophilic
NLS Segment(s)
PositionSequence
31-39RWRRRKRRP
Subcellular Location(s) nucl 13.5, cyto_nucl 12.5, cyto 8.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR045340  DUF6533  
Gene Ontology GO:0016020  C:membrane  
KEGG mpr:MPER_08914  -  
Pfam View protein in Pfam  
PF20151  DUF6533  
Amino Acid Sequences MEHFRSQDLAFSPSFPQPEAAVSSYINPGLRWRRRKRRPSSSSFTKAISRRCVFVVRRDIAIEVGGDADGARNIKVVGLTWGLHDYLVTLEDEIKYIWPLKRSFNKFMFFWIRYYTITLLVFDVVQIHTFSIPGVTSDNV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.21
3 0.2
4 0.18
5 0.19
6 0.21
7 0.19
8 0.17
9 0.16
10 0.17
11 0.17
12 0.18
13 0.17
14 0.13
15 0.19
16 0.28
17 0.37
18 0.46
19 0.56
20 0.65
21 0.75
22 0.86
23 0.89
24 0.9
25 0.91
26 0.89
27 0.88
28 0.87
29 0.83
30 0.74
31 0.66
32 0.61
33 0.56
34 0.53
35 0.52
36 0.43
37 0.38
38 0.38
39 0.43
40 0.38
41 0.41
42 0.44
43 0.36
44 0.35
45 0.34
46 0.33
47 0.26
48 0.24
49 0.16
50 0.07
51 0.06
52 0.05
53 0.04
54 0.04
55 0.03
56 0.03
57 0.04
58 0.04
59 0.04
60 0.04
61 0.04
62 0.04
63 0.05
64 0.06
65 0.07
66 0.07
67 0.08
68 0.09
69 0.08
70 0.08
71 0.08
72 0.06
73 0.05
74 0.06
75 0.05
76 0.05
77 0.05
78 0.06
79 0.06
80 0.06
81 0.06
82 0.07
83 0.11
84 0.13
85 0.17
86 0.19
87 0.27
88 0.37
89 0.43
90 0.5
91 0.52
92 0.54
93 0.5
94 0.55
95 0.55
96 0.46
97 0.42
98 0.37
99 0.34
100 0.3
101 0.33
102 0.27
103 0.22
104 0.22
105 0.2
106 0.17
107 0.15
108 0.14
109 0.11
110 0.12
111 0.08
112 0.09
113 0.09
114 0.09
115 0.09
116 0.09
117 0.09
118 0.08
119 0.08
120 0.08