Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4U0VWK9

Protein Details
Accession A0A4U0VWK9   
Localization Confidence High
Confidence Score 16.3
NoLS Segment(s)
PositionSequenceProtein Nature
295-321TGGGEQLSKKQRKKLRMKKEAAKAGGKBasic
NLS Segment(s)
PositionSequence
232-235KKKR
278-282KRKRK
301-321LSKKQRKKLRMKKEAAKAGGK
Subcellular Location(s) nucl 17.5, cyto_nucl 14, cyto 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011082  Exosome-assoc_fac/DNA_repair  
IPR007146  Sas10/Utp3/C1D  
Gene Ontology GO:0005634  C:nucleus  
GO:0003723  F:RNA binding  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF04000  Sas10_Utp3  
Amino Acid Sequences MADTDPSATLAELSTSLTALEQALDPLLATPLQQHLEHSAAAADSPLLQARAHILASYVVHDLVWVYLKAAGIEPASHPVMQELERLKGYFGKLKAAQNGQSTTSSNKPDRPRMQIDKAAANRFISAAISSSRAAVDPNYTPASDDEDGSLAAATGPSGTHTRFTEAEKEDLDRLLEDHDVSDEDEDEDSDRDAEDSVVEEMLRGVRNGLAEAKKTRKDVEAATAGASSTGKKKRKAMDPFAGYDQPKPASATPTKSAPAPDASTTATDAGTPASDGKRKRKDVGAVEKDAAAGTGGGEQLSKKQRKKLRMKKEAAKAGGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.08
4 0.08
5 0.08
6 0.07
7 0.08
8 0.07
9 0.07
10 0.07
11 0.07
12 0.07
13 0.07
14 0.08
15 0.07
16 0.07
17 0.08
18 0.12
19 0.15
20 0.15
21 0.16
22 0.18
23 0.2
24 0.2
25 0.18
26 0.15
27 0.12
28 0.12
29 0.11
30 0.07
31 0.06
32 0.07
33 0.08
34 0.08
35 0.08
36 0.08
37 0.11
38 0.13
39 0.12
40 0.11
41 0.11
42 0.12
43 0.12
44 0.14
45 0.12
46 0.1
47 0.1
48 0.1
49 0.09
50 0.08
51 0.09
52 0.07
53 0.07
54 0.09
55 0.09
56 0.1
57 0.1
58 0.11
59 0.09
60 0.1
61 0.1
62 0.13
63 0.14
64 0.13
65 0.13
66 0.12
67 0.14
68 0.14
69 0.18
70 0.16
71 0.17
72 0.18
73 0.19
74 0.19
75 0.2
76 0.21
77 0.22
78 0.21
79 0.25
80 0.29
81 0.33
82 0.37
83 0.38
84 0.4
85 0.38
86 0.39
87 0.34
88 0.31
89 0.28
90 0.26
91 0.28
92 0.29
93 0.28
94 0.34
95 0.38
96 0.46
97 0.5
98 0.54
99 0.58
100 0.6
101 0.63
102 0.61
103 0.57
104 0.55
105 0.54
106 0.5
107 0.43
108 0.35
109 0.29
110 0.24
111 0.22
112 0.14
113 0.1
114 0.08
115 0.07
116 0.09
117 0.08
118 0.09
119 0.09
120 0.08
121 0.09
122 0.08
123 0.1
124 0.09
125 0.12
126 0.12
127 0.12
128 0.13
129 0.13
130 0.18
131 0.15
132 0.15
133 0.12
134 0.11
135 0.11
136 0.11
137 0.1
138 0.04
139 0.04
140 0.03
141 0.03
142 0.03
143 0.03
144 0.04
145 0.05
146 0.06
147 0.08
148 0.09
149 0.11
150 0.12
151 0.14
152 0.2
153 0.2
154 0.21
155 0.2
156 0.21
157 0.19
158 0.18
159 0.17
160 0.1
161 0.09
162 0.08
163 0.08
164 0.06
165 0.06
166 0.06
167 0.06
168 0.07
169 0.06
170 0.06
171 0.06
172 0.06
173 0.06
174 0.06
175 0.06
176 0.06
177 0.06
178 0.06
179 0.05
180 0.05
181 0.05
182 0.05
183 0.05
184 0.05
185 0.06
186 0.05
187 0.05
188 0.05
189 0.07
190 0.07
191 0.06
192 0.06
193 0.07
194 0.08
195 0.09
196 0.13
197 0.13
198 0.16
199 0.22
200 0.28
201 0.31
202 0.32
203 0.34
204 0.31
205 0.32
206 0.31
207 0.32
208 0.29
209 0.26
210 0.25
211 0.23
212 0.2
213 0.18
214 0.16
215 0.11
216 0.15
217 0.23
218 0.29
219 0.33
220 0.4
221 0.48
222 0.58
223 0.66
224 0.68
225 0.69
226 0.68
227 0.67
228 0.65
229 0.62
230 0.53
231 0.45
232 0.4
233 0.31
234 0.27
235 0.27
236 0.23
237 0.25
238 0.28
239 0.32
240 0.31
241 0.34
242 0.34
243 0.32
244 0.32
245 0.28
246 0.28
247 0.25
248 0.24
249 0.22
250 0.22
251 0.22
252 0.21
253 0.19
254 0.15
255 0.12
256 0.11
257 0.09
258 0.08
259 0.08
260 0.1
261 0.14
262 0.19
263 0.26
264 0.36
265 0.45
266 0.51
267 0.55
268 0.6
269 0.64
270 0.69
271 0.74
272 0.72
273 0.66
274 0.62
275 0.57
276 0.5
277 0.41
278 0.31
279 0.19
280 0.11
281 0.07
282 0.07
283 0.07
284 0.07
285 0.08
286 0.08
287 0.16
288 0.26
289 0.35
290 0.39
291 0.48
292 0.57
293 0.67
294 0.78
295 0.81
296 0.83
297 0.85
298 0.89
299 0.9
300 0.92
301 0.91