Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4U0W5U3

Protein Details
Accession A0A4U0W5U3    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
11-37AQSKGGAAKKKKWSKGKVKDKANNAVVHydrophilic
NLS Segment(s)
PositionSequence
13-31SKGGAAKKKKWSKGKVKDK
Subcellular Location(s) mito 12, cyto 11.5, cyto_nucl 8, nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MGLAKAAGAAAQSKGGAAKKKKWSKGKVKDKANNAVVCDKPTFDRIMKEVPTFKMISQSVLIERMKINGSLARVAIQHLHKEGLIKPVIHHRAQLVYTRATAEADA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.16
3 0.23
4 0.28
5 0.36
6 0.46
7 0.56
8 0.65
9 0.72
10 0.78
11 0.81
12 0.86
13 0.88
14 0.87
15 0.89
16 0.87
17 0.84
18 0.83
19 0.78
20 0.69
21 0.6
22 0.56
23 0.46
24 0.41
25 0.35
26 0.26
27 0.21
28 0.2
29 0.21
30 0.16
31 0.17
32 0.17
33 0.21
34 0.22
35 0.23
36 0.24
37 0.22
38 0.23
39 0.22
40 0.2
41 0.21
42 0.19
43 0.19
44 0.16
45 0.16
46 0.14
47 0.18
48 0.17
49 0.13
50 0.13
51 0.13
52 0.13
53 0.13
54 0.13
55 0.11
56 0.12
57 0.12
58 0.12
59 0.12
60 0.11
61 0.12
62 0.16
63 0.16
64 0.17
65 0.17
66 0.18
67 0.17
68 0.2
69 0.21
70 0.22
71 0.23
72 0.21
73 0.22
74 0.31
75 0.36
76 0.35
77 0.34
78 0.3
79 0.32
80 0.33
81 0.38
82 0.32
83 0.28
84 0.29
85 0.29
86 0.27