Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G4TGW4

Protein Details
Accession G4TGW4    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
113-141AEAKTAKNRAKRQKRKEAARQKGKGKPKGBasic
NLS Segment(s)
PositionSequence
104-146RRKREREEEAEAKTAKNRAKRQKRKEAARQKGKGKPKGDVPER
Subcellular Location(s) nucl 23.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR009548  Prkrip1  
Gene Ontology GO:0003725  F:double-stranded RNA binding  
Pfam View protein in Pfam  
PF06658  DUF1168  
Amino Acid Sequences MADKDASEEKKEPRKYPKTGVDFNRAQLERLLKNPDKPVVLPEPPKEKTIRPPKDMVKNVQGSSAGAGSGEFHVYKASRRREYERIKLMEDEKAKEEMEAVTERRKREREEEAEAKTAKNRAKRQKRKEAARQKGKGKPKGDVPERKEQAGGGDSESDDGRPGPDVPFKKKRLVAPEVISVAKAPSEDEDEEMAPTSAPAASTVKANVTIHDED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.72
3 0.77
4 0.78
5 0.77
6 0.79
7 0.78
8 0.76
9 0.69
10 0.65
11 0.65
12 0.55
13 0.47
14 0.43
15 0.42
16 0.35
17 0.37
18 0.43
19 0.37
20 0.42
21 0.46
22 0.46
23 0.42
24 0.4
25 0.41
26 0.39
27 0.42
28 0.42
29 0.43
30 0.47
31 0.46
32 0.49
33 0.46
34 0.42
35 0.47
36 0.52
37 0.55
38 0.51
39 0.57
40 0.62
41 0.69
42 0.71
43 0.66
44 0.64
45 0.61
46 0.56
47 0.51
48 0.43
49 0.33
50 0.28
51 0.23
52 0.13
53 0.08
54 0.07
55 0.06
56 0.06
57 0.07
58 0.06
59 0.06
60 0.08
61 0.08
62 0.14
63 0.21
64 0.29
65 0.34
66 0.38
67 0.44
68 0.53
69 0.6
70 0.64
71 0.65
72 0.59
73 0.55
74 0.53
75 0.49
76 0.45
77 0.39
78 0.32
79 0.25
80 0.24
81 0.22
82 0.19
83 0.18
84 0.12
85 0.12
86 0.12
87 0.11
88 0.17
89 0.2
90 0.22
91 0.27
92 0.29
93 0.3
94 0.33
95 0.41
96 0.39
97 0.43
98 0.47
99 0.45
100 0.46
101 0.44
102 0.39
103 0.32
104 0.32
105 0.28
106 0.3
107 0.37
108 0.43
109 0.54
110 0.65
111 0.73
112 0.79
113 0.85
114 0.87
115 0.89
116 0.9
117 0.89
118 0.89
119 0.86
120 0.83
121 0.82
122 0.82
123 0.79
124 0.7
125 0.63
126 0.61
127 0.63
128 0.64
129 0.66
130 0.62
131 0.65
132 0.64
133 0.61
134 0.53
135 0.43
136 0.36
137 0.29
138 0.24
139 0.14
140 0.13
141 0.12
142 0.13
143 0.13
144 0.1
145 0.09
146 0.08
147 0.07
148 0.08
149 0.09
150 0.1
151 0.18
152 0.23
153 0.31
154 0.41
155 0.44
156 0.5
157 0.54
158 0.58
159 0.59
160 0.6
161 0.59
162 0.53
163 0.55
164 0.51
165 0.46
166 0.4
167 0.31
168 0.25
169 0.19
170 0.14
171 0.1
172 0.09
173 0.13
174 0.14
175 0.16
176 0.17
177 0.17
178 0.18
179 0.18
180 0.16
181 0.12
182 0.11
183 0.09
184 0.08
185 0.07
186 0.09
187 0.1
188 0.11
189 0.13
190 0.14
191 0.15
192 0.2
193 0.2
194 0.2