FuNGI

A0A4U0VYS3

Protein Details

Accession

A0A4U0VYS3

Localization Confidence

Medium

Confidence Score

10.3

NoLS Segment(s)

Position	Sequence	Protein Nature
526-550	YDQLRNKPLPVPKPRDRKPAPPAAA	Hydrophilic

NLS Segment(s)

Position	Sequence
536-549	VPKPRDRKPAPPAA

Subcellular Location(s)

cyto 9.5, cyto_nucl 9.5, nucl 8.5, pero 5, cysk 4

Family & Domain DBs

InterPro	View protein in InterPro IPR019382 eIF3l IPR000717 PCI_dom
Gene Ontology	GO:0016282 C:eukaryotic 43S preinitiation complex GO:0033290 C:eukaryotic 48S preinitiation complex GO:0005852 C:eukaryotic translation initiation factor 3 complex GO:0003743 F:translation initiation factor activity GO:0001732 P:formation of cytoplasmic translation initiation complex
Pfam	View protein in Pfam PF10255 Paf67
PROSITE	View protein in PROSITE PS50250 PCI

Amino Acid Sequences

MQPYDLVDEGDFEGADLAIPAVAYDDAGNEQIAQQQRIAEAAASQAHALEQLASVPEPVKRYLISLWSLLNQQNPNLAEIHSAYEQGWNRLSDKFFPKQEWPDAEVIAPLVNHDEAYCNLFNLILNSSGPVPLTLPIDWIYNIIDEFVYQYTSFALWRNKTQGKTEEEKAILAESGQVWSCYSVLNVLYSLIQKSKILDQLAAAQKGEDVEAAAGEYGSIPLYHHLGYFSVLALVRVHVLLGDYTLALSMLDHIELDKKALLTRVTAAHVSTYYYVGFAYLMLGRYPDAIRSFSHILFFVLRLKHFQRGSQFDQINKTADRMYALLAIAQALCPTKVDEGIATAMKDKFGDQYGKMVRGGPDALASFQELFTHGAPRFISPNPPPYESESDETLAAFAAQPDPSQHQLAIFLAAVEPQLSTSTLRSFLRLYTTLGTDKLAKFLDLDDEETVLEMLMTAKAAARKVTWTSGGLLEGEETPVSDINFGISEASPAPFSHGHLTVAQSTTSRRYGDFFSRHALKFADVYDQLRNKPLPVPKPRDRKPAPPAAAAAAGGAADAGRREVGARA

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.08
2	0.08
3	0.06
4	0.05
5	0.05
6	0.05
7	0.04
8	0.05
9	0.05
10	0.06
11	0.05
12	0.07
13	0.08
14	0.09
15	0.09
16	0.08
17	0.09
18	0.14
19	0.19
20	0.19
21	0.19
22	0.19
23	0.2
24	0.2
25	0.2
26	0.15
27	0.11
28	0.12
29	0.13
30	0.12
31	0.12
32	0.11
33	0.1
34	0.11
35	0.1
36	0.08
37	0.06
38	0.07
39	0.09
40	0.09
41	0.1
42	0.11
43	0.13
44	0.15
45	0.17
46	0.18
47	0.17
48	0.19
49	0.21
50	0.24
51	0.24
52	0.24
53	0.24
54	0.24
55	0.28
56	0.27
57	0.31
58	0.28
59	0.26
60	0.3
61	0.29
62	0.28
63	0.25
64	0.23
65	0.19
66	0.18
67	0.21
68	0.15
69	0.16
70	0.14
71	0.2
72	0.22
73	0.22
74	0.25
75	0.23
76	0.24
77	0.28
78	0.3
79	0.3
80	0.36
81	0.4
82	0.41
83	0.44
84	0.49
85	0.52
86	0.57
87	0.55
88	0.52
89	0.46
90	0.43
91	0.39
92	0.32
93	0.25
94	0.18
95	0.13
96	0.09
97	0.09
98	0.08
99	0.08
100	0.08
101	0.09
102	0.09
103	0.15
104	0.14
105	0.12
106	0.12
107	0.13
108	0.13
109	0.13
110	0.13
111	0.09
112	0.09
113	0.1
114	0.1
115	0.1
116	0.1
117	0.09
118	0.08
119	0.09
120	0.11
121	0.1
122	0.11
123	0.12
124	0.13
125	0.13
126	0.13
127	0.11
128	0.1
129	0.1
130	0.08
131	0.07
132	0.06
133	0.08
134	0.07
135	0.08
136	0.07
137	0.08
138	0.08
139	0.08
140	0.09
141	0.13
142	0.19
143	0.2
144	0.24
145	0.32
146	0.37
147	0.39
148	0.44
149	0.46
150	0.46
151	0.49
152	0.49
153	0.47
154	0.42
155	0.4
156	0.34
157	0.28
158	0.21
159	0.15
160	0.13
161	0.07
162	0.08
163	0.08
164	0.08
165	0.07
166	0.08
167	0.08
168	0.07
169	0.07
170	0.07
171	0.07
172	0.07
173	0.07
174	0.07
175	0.08
176	0.09
177	0.1
178	0.1
179	0.1
180	0.1
181	0.12
182	0.15
183	0.18
184	0.18
185	0.17
186	0.17
187	0.24
188	0.28
189	0.28
190	0.24
191	0.19
192	0.19
193	0.19
194	0.18
195	0.1
196	0.05
197	0.04
198	0.04
199	0.04
200	0.04
201	0.03
202	0.03
203	0.03
204	0.03
205	0.03
206	0.03
207	0.04
208	0.04
209	0.06
210	0.07
211	0.07
212	0.07
213	0.07
214	0.08
215	0.08
216	0.07
217	0.08
218	0.07
219	0.08
220	0.07
221	0.07
222	0.07
223	0.06
224	0.06
225	0.04
226	0.05
227	0.04
228	0.04
229	0.04
230	0.03
231	0.03
232	0.04
233	0.03
234	0.03
235	0.03
236	0.04
237	0.04
238	0.04
239	0.04
240	0.04
241	0.06
242	0.06
243	0.07
244	0.07
245	0.07
246	0.08
247	0.1
248	0.1
249	0.09
250	0.11
251	0.12
252	0.13
253	0.13
254	0.12
255	0.11
256	0.1
257	0.1
258	0.09
259	0.08
260	0.07
261	0.06
262	0.06
263	0.06
264	0.06
265	0.05
266	0.05
267	0.05
268	0.05
269	0.05
270	0.06
271	0.06
272	0.07
273	0.07
274	0.08
275	0.08
276	0.09
277	0.1
278	0.14
279	0.17
280	0.15
281	0.16
282	0.15
283	0.14
284	0.13
285	0.14
286	0.14
287	0.13
288	0.13
289	0.16
290	0.17
291	0.23
292	0.23
293	0.25
294	0.27
295	0.32
296	0.37
297	0.41
298	0.41
299	0.38
300	0.41
301	0.4
302	0.36
303	0.29
304	0.25
305	0.18
306	0.17
307	0.15
308	0.12
309	0.11
310	0.1
311	0.1
312	0.09
313	0.08
314	0.08
315	0.07
316	0.06
317	0.06
318	0.05
319	0.05
320	0.05
321	0.06
322	0.06
323	0.06
324	0.07
325	0.06
326	0.07
327	0.09
328	0.09
329	0.09
330	0.11
331	0.11
332	0.11
333	0.11
334	0.1
335	0.1
336	0.13
337	0.15
338	0.13
339	0.2
340	0.23
341	0.24
342	0.24
343	0.25
344	0.22
345	0.21
346	0.22
347	0.14
348	0.13
349	0.11
350	0.11
351	0.1
352	0.1
353	0.08
354	0.08
355	0.08
356	0.07
357	0.09
358	0.09
359	0.13
360	0.13
361	0.15
362	0.15
363	0.16
364	0.18
365	0.17
366	0.23
367	0.21
368	0.3
369	0.31
370	0.33
371	0.34
372	0.37
373	0.42
374	0.38
375	0.38
376	0.31
377	0.29
378	0.26
379	0.24
380	0.18
381	0.12
382	0.1
383	0.07
384	0.06
385	0.06
386	0.06
387	0.07
388	0.08
389	0.12
390	0.14
391	0.15
392	0.15
393	0.14
394	0.15
395	0.15
396	0.14
397	0.11
398	0.08
399	0.07
400	0.07
401	0.07
402	0.06
403	0.05
404	0.04
405	0.05
406	0.06
407	0.07
408	0.08
409	0.1
410	0.14
411	0.14
412	0.16
413	0.16
414	0.16
415	0.21
416	0.21
417	0.21
418	0.2
419	0.22
420	0.22
421	0.21
422	0.22
423	0.21
424	0.2
425	0.21
426	0.2
427	0.17
428	0.16
429	0.16
430	0.21
431	0.17
432	0.19
433	0.16
434	0.16
435	0.15
436	0.15
437	0.14
438	0.08
439	0.07
440	0.04
441	0.05
442	0.04
443	0.05
444	0.05
445	0.07
446	0.09
447	0.11
448	0.12
449	0.12
450	0.16
451	0.19
452	0.22
453	0.22
454	0.21
455	0.22
456	0.22
457	0.22
458	0.19
459	0.16
460	0.14
461	0.12
462	0.11
463	0.09
464	0.08
465	0.08
466	0.09
467	0.09
468	0.08
469	0.08
470	0.08
471	0.08
472	0.08
473	0.09
474	0.08
475	0.09
476	0.1
477	0.11
478	0.11
479	0.1
480	0.15
481	0.14
482	0.16
483	0.2
484	0.2
485	0.21
486	0.22
487	0.25
488	0.24
489	0.24
490	0.23
491	0.19
492	0.21
493	0.24
494	0.26
495	0.25
496	0.22
497	0.24
498	0.29
499	0.37
500	0.39
501	0.37
502	0.41
503	0.47
504	0.47
505	0.47
506	0.42
507	0.34
508	0.32
509	0.3
510	0.29
511	0.24
512	0.26
513	0.32
514	0.36
515	0.36
516	0.4
517	0.4
518	0.35
519	0.4
520	0.46
521	0.47
522	0.53
523	0.61
524	0.64
525	0.75
526	0.81
527	0.85
528	0.82
529	0.83
530	0.81
531	0.83
532	0.78
533	0.71
534	0.65
535	0.57
536	0.52
537	0.42
538	0.32
539	0.21
540	0.16
541	0.11
542	0.09
543	0.05
544	0.04
545	0.05
546	0.06
547	0.06
548	0.06

A0A4U0VYS3

3D AlphaFold-predicted Structure Viewer