Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4T0FDU1

Protein Details
Accession A0A4T0FDU1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
2-24FRNSVKSLKKITKKVFHRTPPSIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 25
Family & Domain DBs
Amino Acid Sequences MFRNSVKSLKKITKKVFHRTPPSIDELKLVTISSTSLDSLYKGSTTLKQAFQEAVNDPGLALNTHKAAKKIKVVVQLSDIAEEQSARIETW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.82
3 0.83
4 0.83
5 0.83
6 0.78
7 0.74
8 0.68
9 0.66
10 0.58
11 0.48
12 0.41
13 0.32
14 0.27
15 0.22
16 0.18
17 0.11
18 0.09
19 0.09
20 0.07
21 0.07
22 0.06
23 0.06
24 0.06
25 0.07
26 0.07
27 0.07
28 0.07
29 0.07
30 0.08
31 0.1
32 0.14
33 0.16
34 0.18
35 0.18
36 0.19
37 0.2
38 0.19
39 0.19
40 0.16
41 0.16
42 0.14
43 0.13
44 0.12
45 0.11
46 0.11
47 0.09
48 0.08
49 0.07
50 0.09
51 0.12
52 0.14
53 0.17
54 0.22
55 0.26
56 0.33
57 0.38
58 0.41
59 0.47
60 0.47
61 0.46
62 0.44
63 0.44
64 0.37
65 0.32
66 0.28
67 0.19
68 0.17
69 0.15
70 0.12
71 0.11