Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4T0FMS3

Protein Details
Accession A0A4T0FMS3    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
97-117ENGGARKRIRIRRGMRRHSFQBasic
NLS Segment(s)
PositionSequence
101-113ARKRIRIRRGMRR
Subcellular Location(s) mito_nucl 11.166, nucl 11, mito 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR005301  MOB_kinase_act_fam  
IPR036703  MOB_kinase_act_sf  
Pfam View protein in Pfam  
PF03637  Mob1_phocein  
Amino Acid Sequences MAQLGNKKSNNSLRASNRIQSPSAVATPTTAQAVVTKSGSGGDMQRKKSHEILKSHQKRFNMSARDRGSGARLNTDQNTPESVQHGVHEQDREDENENGGARKRIRIRRGMRRHSFQNAQCSTSSTHDSPFQLQEHLNYLLRNRHPVDAQVKLPQTAHSDSNTTWLWIYEHLRCLARDLNTPWMTLLQDECACPEMKANDATFVCVSHCAHRKSKCSAVDYSTHNLNSVADDLNDVSLAGSVDTQKSVLRRLTRIVAHVYAHHRDVFLVCEAETGVARRIAKLSKEYGILPQYIIIWDDSDDDKETLDHADGFNTRRTPSTPRQLIDVGPVSASEDSDSDEYNSDED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.64
3 0.62
4 0.61
5 0.59
6 0.56
7 0.48
8 0.44
9 0.39
10 0.36
11 0.31
12 0.23
13 0.21
14 0.21
15 0.21
16 0.19
17 0.14
18 0.12
19 0.14
20 0.16
21 0.17
22 0.16
23 0.15
24 0.14
25 0.14
26 0.15
27 0.13
28 0.17
29 0.25
30 0.32
31 0.36
32 0.42
33 0.44
34 0.48
35 0.54
36 0.56
37 0.54
38 0.54
39 0.59
40 0.65
41 0.73
42 0.77
43 0.73
44 0.68
45 0.66
46 0.65
47 0.65
48 0.63
49 0.57
50 0.58
51 0.58
52 0.57
53 0.52
54 0.47
55 0.42
56 0.37
57 0.34
58 0.3
59 0.28
60 0.3
61 0.31
62 0.33
63 0.3
64 0.26
65 0.29
66 0.24
67 0.23
68 0.21
69 0.2
70 0.18
71 0.17
72 0.19
73 0.17
74 0.19
75 0.19
76 0.18
77 0.2
78 0.21
79 0.23
80 0.23
81 0.22
82 0.2
83 0.21
84 0.21
85 0.19
86 0.19
87 0.21
88 0.19
89 0.25
90 0.33
91 0.39
92 0.45
93 0.53
94 0.61
95 0.67
96 0.77
97 0.81
98 0.8
99 0.78
100 0.78
101 0.75
102 0.74
103 0.67
104 0.66
105 0.57
106 0.51
107 0.45
108 0.41
109 0.36
110 0.31
111 0.31
112 0.22
113 0.21
114 0.22
115 0.23
116 0.24
117 0.24
118 0.22
119 0.2
120 0.2
121 0.19
122 0.2
123 0.21
124 0.19
125 0.17
126 0.18
127 0.22
128 0.23
129 0.27
130 0.25
131 0.25
132 0.24
133 0.29
134 0.3
135 0.27
136 0.28
137 0.28
138 0.27
139 0.26
140 0.26
141 0.23
142 0.23
143 0.21
144 0.21
145 0.16
146 0.18
147 0.16
148 0.2
149 0.18
150 0.15
151 0.13
152 0.11
153 0.11
154 0.12
155 0.14
156 0.12
157 0.14
158 0.16
159 0.17
160 0.16
161 0.18
162 0.19
163 0.18
164 0.19
165 0.19
166 0.26
167 0.25
168 0.25
169 0.23
170 0.21
171 0.19
172 0.16
173 0.15
174 0.08
175 0.08
176 0.08
177 0.09
178 0.09
179 0.1
180 0.09
181 0.1
182 0.09
183 0.1
184 0.13
185 0.12
186 0.15
187 0.15
188 0.16
189 0.15
190 0.14
191 0.13
192 0.13
193 0.13
194 0.16
195 0.22
196 0.25
197 0.32
198 0.37
199 0.42
200 0.45
201 0.52
202 0.5
203 0.48
204 0.46
205 0.43
206 0.42
207 0.41
208 0.39
209 0.35
210 0.3
211 0.27
212 0.24
213 0.21
214 0.17
215 0.14
216 0.11
217 0.08
218 0.08
219 0.08
220 0.08
221 0.07
222 0.06
223 0.05
224 0.05
225 0.05
226 0.04
227 0.05
228 0.06
229 0.07
230 0.07
231 0.07
232 0.09
233 0.1
234 0.14
235 0.19
236 0.22
237 0.23
238 0.27
239 0.32
240 0.32
241 0.34
242 0.34
243 0.31
244 0.28
245 0.31
246 0.33
247 0.3
248 0.3
249 0.28
250 0.24
251 0.22
252 0.22
253 0.19
254 0.16
255 0.13
256 0.11
257 0.11
258 0.11
259 0.11
260 0.11
261 0.1
262 0.1
263 0.13
264 0.13
265 0.14
266 0.17
267 0.2
268 0.23
269 0.26
270 0.28
271 0.27
272 0.29
273 0.29
274 0.32
275 0.31
276 0.29
277 0.24
278 0.21
279 0.19
280 0.17
281 0.17
282 0.12
283 0.09
284 0.09
285 0.12
286 0.12
287 0.13
288 0.15
289 0.14
290 0.14
291 0.14
292 0.14
293 0.13
294 0.13
295 0.13
296 0.1
297 0.14
298 0.17
299 0.19
300 0.24
301 0.25
302 0.24
303 0.26
304 0.29
305 0.34
306 0.41
307 0.49
308 0.51
309 0.5
310 0.54
311 0.54
312 0.51
313 0.5
314 0.44
315 0.33
316 0.26
317 0.25
318 0.22
319 0.2
320 0.19
321 0.13
322 0.1
323 0.12
324 0.13
325 0.15
326 0.14
327 0.15