Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4T0FHS0

Protein Details
Accession A0A4T0FHS0    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
4-26VSLSKAIKTKKPNRSVGKHVDKLHydrophilic
NLS Segment(s)
PositionSequence
60-71RREVGRGGRRAL
Subcellular Location(s) mito 16.5, cyto_mito 10, nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
Gene Ontology GO:0046982  F:protein heterodimerization activity  
Amino Acid Sequences MAPVSLSKAIKTKKPNRSVGKHVDKLAYLALLCFLQRTAQETRIVSQEIHGHDHNRKMTRREVGRGGRRALRRVNANAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.75
3 0.77
4 0.8
5 0.82
6 0.82
7 0.82
8 0.76
9 0.7
10 0.61
11 0.52
12 0.45
13 0.36
14 0.26
15 0.16
16 0.11
17 0.09
18 0.07
19 0.07
20 0.06
21 0.05
22 0.05
23 0.06
24 0.1
25 0.12
26 0.14
27 0.17
28 0.17
29 0.18
30 0.19
31 0.2
32 0.16
33 0.15
34 0.17
35 0.16
36 0.2
37 0.2
38 0.21
39 0.24
40 0.3
41 0.34
42 0.37
43 0.4
44 0.4
45 0.45
46 0.51
47 0.53
48 0.53
49 0.56
50 0.6
51 0.65
52 0.67
53 0.65
54 0.64
55 0.64
56 0.64
57 0.63
58 0.6
59 0.58