Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4T0FWT4

Protein Details
Accession A0A4T0FWT4    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-33VNIPKTRRTYCKGKQCRKHTPHKVTQYKKGKDSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, cyto_nucl 10, mito 8, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences VNIPKTRRTYCKGKQCRKHTPHKVTQYKKGKDSIYAQGKRRYDRKQSGFGGQTKPVFHKKAKTTKKVVLRLECSVCKYKMQLSLKRTKHFELGGEKKQKGAALVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.86
3 0.91
4 0.89
5 0.9
6 0.9
7 0.89
8 0.88
9 0.89
10 0.89
11 0.85
12 0.87
13 0.86
14 0.81
15 0.76
16 0.71
17 0.62
18 0.56
19 0.54
20 0.53
21 0.53
22 0.53
23 0.54
24 0.56
25 0.58
26 0.58
27 0.61
28 0.58
29 0.57
30 0.61
31 0.61
32 0.62
33 0.6
34 0.61
35 0.58
36 0.55
37 0.48
38 0.41
39 0.37
40 0.3
41 0.31
42 0.31
43 0.3
44 0.28
45 0.33
46 0.38
47 0.47
48 0.55
49 0.59
50 0.61
51 0.64
52 0.71
53 0.72
54 0.7
55 0.67
56 0.62
57 0.59
58 0.57
59 0.52
60 0.47
61 0.44
62 0.39
63 0.33
64 0.31
65 0.3
66 0.35
67 0.41
68 0.44
69 0.47
70 0.56
71 0.62
72 0.67
73 0.67
74 0.6
75 0.58
76 0.52
77 0.5
78 0.51
79 0.52
80 0.55
81 0.59
82 0.56
83 0.53
84 0.53
85 0.48