Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4T0FS23

Protein Details
Accession A0A4T0FS23    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
17-39SAYAGAGRRRRRRVNCVYIRPVLHydrophilic
NLS Segment(s)
PositionSequence
24-28RRRRR
Subcellular Location(s) mito 20, extr 4, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR004202  COX7C/Cox8  
IPR036636  COX7C/Cox8_sf  
Gene Ontology GO:0005751  C:mitochondrial respiratory chain complex IV  
GO:0006123  P:mitochondrial electron transport, cytochrome c to oxygen  
Pfam View protein in Pfam  
PF02935  COX7C  
Amino Acid Sequences AAASAPSALFPVRRSASAYAGAGRRRRRRVNCVYIRPVLTPSPPTTTTMLARPALRQLASAPKGVRAIHIENKVHDTMPFRTNGGGFGLKLAVGSVIGFGTPFFAAWYHG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.25
3 0.27
4 0.29
5 0.29
6 0.26
7 0.29
8 0.34
9 0.37
10 0.44
11 0.5
12 0.56
13 0.65
14 0.68
15 0.74
16 0.78
17 0.83
18 0.83
19 0.83
20 0.8
21 0.74
22 0.68
23 0.59
24 0.51
25 0.41
26 0.33
27 0.27
28 0.23
29 0.23
30 0.22
31 0.23
32 0.22
33 0.23
34 0.22
35 0.21
36 0.22
37 0.19
38 0.19
39 0.17
40 0.17
41 0.17
42 0.15
43 0.13
44 0.12
45 0.18
46 0.19
47 0.21
48 0.19
49 0.2
50 0.22
51 0.22
52 0.22
53 0.18
54 0.21
55 0.25
56 0.31
57 0.3
58 0.29
59 0.33
60 0.32
61 0.29
62 0.26
63 0.23
64 0.21
65 0.23
66 0.22
67 0.19
68 0.2
69 0.2
70 0.19
71 0.18
72 0.16
73 0.13
74 0.13
75 0.13
76 0.11
77 0.11
78 0.1
79 0.06
80 0.05
81 0.05
82 0.05
83 0.04
84 0.04
85 0.04
86 0.04
87 0.06
88 0.06
89 0.06
90 0.06