Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4T0FLC5

Protein Details
Accession A0A4T0FLC5   
Localization Confidence Low
Confidence Score 7.1
NoLS Segment(s)
PositionSequenceProtein Nature
16-35SNWNRCYSTQPKPPPQQSQSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, nucl 6, cyto 5, plas 3, cyto_pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR045866  FAM210A/B-like  
IPR009688  FAM210A/B-like_dom  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF06916  FAM210A-B_dom  
Amino Acid Sequences MMRNALRNLRIRTAGSNWNRCYSTQPKPPPQQSQSLAQRFKELSKKYGWVAVGVYTAISVLDFSAAFAAVNVVGAERVKVLEKKVLNWVGLQTQPSDNDGNEKEDKNSIWAMAVLAYGIHKTLFLPPRLALAAGITPRLVKELQRRGYAVGPNAEKVVARVRKVKERIDRDKH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.51
3 0.55
4 0.53
5 0.55
6 0.54
7 0.5
8 0.52
9 0.5
10 0.5
11 0.51
12 0.58
13 0.62
14 0.71
15 0.78
16 0.81
17 0.77
18 0.76
19 0.69
20 0.69
21 0.69
22 0.68
23 0.64
24 0.54
25 0.55
26 0.48
27 0.5
28 0.49
29 0.42
30 0.37
31 0.36
32 0.39
33 0.35
34 0.38
35 0.32
36 0.25
37 0.22
38 0.19
39 0.16
40 0.13
41 0.11
42 0.07
43 0.06
44 0.05
45 0.04
46 0.03
47 0.03
48 0.03
49 0.03
50 0.03
51 0.04
52 0.04
53 0.04
54 0.04
55 0.04
56 0.03
57 0.03
58 0.03
59 0.03
60 0.03
61 0.03
62 0.04
63 0.03
64 0.04
65 0.06
66 0.07
67 0.08
68 0.14
69 0.14
70 0.16
71 0.22
72 0.24
73 0.22
74 0.22
75 0.22
76 0.18
77 0.19
78 0.18
79 0.13
80 0.11
81 0.12
82 0.13
83 0.13
84 0.11
85 0.14
86 0.15
87 0.18
88 0.2
89 0.2
90 0.19
91 0.2
92 0.2
93 0.18
94 0.17
95 0.13
96 0.11
97 0.1
98 0.09
99 0.08
100 0.07
101 0.05
102 0.04
103 0.05
104 0.04
105 0.04
106 0.04
107 0.04
108 0.05
109 0.12
110 0.17
111 0.19
112 0.21
113 0.21
114 0.23
115 0.24
116 0.23
117 0.16
118 0.12
119 0.14
120 0.12
121 0.13
122 0.1
123 0.1
124 0.1
125 0.13
126 0.12
127 0.15
128 0.24
129 0.34
130 0.39
131 0.43
132 0.44
133 0.45
134 0.49
135 0.48
136 0.43
137 0.4
138 0.36
139 0.33
140 0.33
141 0.31
142 0.25
143 0.22
144 0.28
145 0.26
146 0.28
147 0.35
148 0.41
149 0.5
150 0.57
151 0.64
152 0.65
153 0.7