Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4T0FMG2

Protein Details
Accession A0A4T0FMG2    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
28-57KTVVTTKKTVKKPAKKRAPSAKQDKRPAKSHydrophilic
NLS Segment(s)
PositionSequence
33-56TKKTVKKPAKKRAPSAKQDKRPAK
Subcellular Location(s) nucl 13.5, mito_nucl 10, cyto 8, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR025715  FoP_C  
Gene Ontology GO:0003723  F:RNA binding  
Pfam View protein in Pfam  
PF13865  FoP_duplication  
Amino Acid Sequences MIKVETVLESSNGSVLAQRLAPKPAGAKTVVTTKKTVKKPAKKRAPSAKQDKRPAKSAEDLDAEMEEYTQIKTE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.09
4 0.1
5 0.14
6 0.15
7 0.17
8 0.18
9 0.17
10 0.19
11 0.2
12 0.21
13 0.18
14 0.17
15 0.17
16 0.25
17 0.28
18 0.27
19 0.28
20 0.32
21 0.39
22 0.43
23 0.51
24 0.52
25 0.58
26 0.67
27 0.76
28 0.8
29 0.78
30 0.84
31 0.85
32 0.84
33 0.84
34 0.85
35 0.84
36 0.83
37 0.86
38 0.86
39 0.79
40 0.77
41 0.71
42 0.64
43 0.61
44 0.54
45 0.49
46 0.43
47 0.4
48 0.33
49 0.3
50 0.25
51 0.18
52 0.15
53 0.11
54 0.08