Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4T0FFR1

Protein Details
Accession A0A4T0FFR1    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
20-41NKTFRLKRTLAKKQRQNRPIPQHydrophilic
47-67SDTNIQYNAKRRHWRRTKLHIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24.5, mito_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR000077  Ribosomal_L39  
IPR020083  Ribosomal_L39_CS  
IPR023626  Ribosomal_L39e_dom_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00832  Ribosomal_L39  
PROSITE View protein in PROSITE  
PS00051  RIBOSOMAL_L39E  
Amino Acid Sequences MLMIIKSERAASSFVSYSANKTFRLKRTLAKKQRQNRPIPQWFRLKSDTNIQYNAKRRHWRRTKLHI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.18
3 0.18
4 0.2
5 0.25
6 0.25
7 0.23
8 0.29
9 0.35
10 0.37
11 0.42
12 0.41
13 0.42
14 0.5
15 0.59
16 0.64
17 0.67
18 0.71
19 0.74
20 0.82
21 0.83
22 0.81
23 0.79
24 0.79
25 0.8
26 0.76
27 0.73
28 0.73
29 0.66
30 0.64
31 0.59
32 0.53
33 0.45
34 0.49
35 0.5
36 0.44
37 0.47
38 0.46
39 0.48
40 0.54
41 0.6
42 0.59
43 0.63
44 0.66
45 0.72
46 0.79
47 0.82