Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4T0FKR7

Protein Details
Accession A0A4T0FKR7   
Localization Confidence Low
Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
43-66RIRSRTGRKIIARRLKRGRKNMSHBasic
NLS Segment(s)
PositionSequence
32-64RKRKRTFGFLARIRSRTGRKIIARRLKRGRKNM
Subcellular Location(s) mito 18, mito_nucl 12.833, cyto_mito 10.333, nucl 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MASPATVFSPTLNALNQLRFASRGTDYQPSTRKRKRTFGFLARIRSRTGRKIIARRLKRGRKNMSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.18
3 0.2
4 0.18
5 0.18
6 0.17
7 0.17
8 0.16
9 0.16
10 0.16
11 0.17
12 0.22
13 0.23
14 0.28
15 0.35
16 0.37
17 0.46
18 0.5
19 0.57
20 0.56
21 0.65
22 0.61
23 0.63
24 0.66
25 0.65
26 0.69
27 0.65
28 0.69
29 0.63
30 0.62
31 0.55
32 0.53
33 0.49
34 0.46
35 0.47
36 0.46
37 0.5
38 0.58
39 0.67
40 0.71
41 0.74
42 0.77
43 0.82
44 0.84
45 0.86
46 0.87