Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4T0FD82

Protein Details
Accession A0A4T0FD82    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
81-102ADVVARQKDKKRKDFTSNSSNTHydrophilic
221-240EDEKRRKQTKFRKLDEKLNDBasic
NLS Segment(s)
PositionSequence
223-230EKRRKQTK
Subcellular Location(s) cyto_nucl 14.333, nucl 13, cyto 12.5, mito_nucl 7.499
Family & Domain DBs
InterPro View protein in InterPro  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
IPR000504  RRM_dom  
IPR034393  TatSF1-like  
IPR034392  TatSF1-like_RRM1  
Gene Ontology GO:0003723  F:RNA binding  
GO:0000398  P:mRNA splicing, via spliceosome  
Pfam View protein in Pfam  
PF00076  RRM_1  
PROSITE View protein in PROSITE  
PS50102  RRM  
CDD cd12281  RRM1_TatSF1_like  
cd12285  RRM3_RBM39_like  
Amino Acid Sequences MALPDFENDPRISFDKGKENWVLEDDNGNELEWHSRSQRFVSLVGAISLPHAISQTQPEMDQIKAQQAAYSVNGVDESTPADVVARQKDKKRKDFTSNSSNTEPKKQKGPPPKTAVFVTGLPPDVTVDEIAQVFGKCGVILPNDEGGLKIKLYSDDQGNFKGEALVVYYKDASVTLAIQLLDDTEFRYGDGSSIKVSIADFKSDPSSEKTETQKKHKPLSEDEKRRKQTKFRKLDEKLNDWDSEDESGLADRLPSKTVSRVVVLRHMFTLDELKDDPTLLLDLKQDVREDAEQIGKVTNVVLYDAEPDGVMTVKFSDHIAAQACVLKYQGRFFGGRRVISYLYDGTESFKSAQAANKYSETAEQDEQVRLNDFGKWLEKDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.4
3 0.41
4 0.46
5 0.47
6 0.46
7 0.44
8 0.42
9 0.39
10 0.3
11 0.33
12 0.28
13 0.25
14 0.23
15 0.21
16 0.18
17 0.16
18 0.2
19 0.16
20 0.18
21 0.21
22 0.24
23 0.26
24 0.29
25 0.33
26 0.31
27 0.3
28 0.29
29 0.28
30 0.25
31 0.23
32 0.2
33 0.15
34 0.13
35 0.13
36 0.1
37 0.08
38 0.08
39 0.07
40 0.09
41 0.13
42 0.16
43 0.16
44 0.16
45 0.19
46 0.21
47 0.21
48 0.23
49 0.2
50 0.22
51 0.23
52 0.23
53 0.21
54 0.2
55 0.22
56 0.19
57 0.19
58 0.14
59 0.11
60 0.12
61 0.11
62 0.1
63 0.08
64 0.08
65 0.07
66 0.07
67 0.07
68 0.07
69 0.09
70 0.13
71 0.21
72 0.27
73 0.32
74 0.41
75 0.51
76 0.6
77 0.68
78 0.73
79 0.73
80 0.76
81 0.8
82 0.8
83 0.81
84 0.76
85 0.72
86 0.68
87 0.65
88 0.57
89 0.57
90 0.55
91 0.48
92 0.52
93 0.53
94 0.57
95 0.63
96 0.69
97 0.69
98 0.71
99 0.71
100 0.65
101 0.59
102 0.53
103 0.44
104 0.36
105 0.29
106 0.23
107 0.21
108 0.17
109 0.16
110 0.14
111 0.11
112 0.11
113 0.08
114 0.07
115 0.07
116 0.07
117 0.07
118 0.08
119 0.07
120 0.07
121 0.07
122 0.07
123 0.05
124 0.06
125 0.08
126 0.07
127 0.09
128 0.1
129 0.1
130 0.11
131 0.11
132 0.11
133 0.11
134 0.11
135 0.09
136 0.08
137 0.08
138 0.09
139 0.11
140 0.12
141 0.14
142 0.17
143 0.18
144 0.2
145 0.21
146 0.2
147 0.18
148 0.17
149 0.13
150 0.1
151 0.1
152 0.09
153 0.08
154 0.08
155 0.08
156 0.08
157 0.08
158 0.08
159 0.06
160 0.05
161 0.05
162 0.05
163 0.06
164 0.06
165 0.06
166 0.06
167 0.06
168 0.06
169 0.05
170 0.06
171 0.05
172 0.05
173 0.05
174 0.06
175 0.05
176 0.06
177 0.07
178 0.07
179 0.06
180 0.07
181 0.07
182 0.07
183 0.07
184 0.11
185 0.11
186 0.12
187 0.12
188 0.12
189 0.14
190 0.15
191 0.16
192 0.15
193 0.18
194 0.18
195 0.23
196 0.29
197 0.35
198 0.4
199 0.47
200 0.52
201 0.54
202 0.6
203 0.59
204 0.57
205 0.57
206 0.63
207 0.65
208 0.68
209 0.72
210 0.74
211 0.77
212 0.78
213 0.74
214 0.74
215 0.74
216 0.74
217 0.75
218 0.72
219 0.77
220 0.76
221 0.8
222 0.77
223 0.72
224 0.66
225 0.58
226 0.51
227 0.41
228 0.37
229 0.28
230 0.22
231 0.17
232 0.12
233 0.09
234 0.09
235 0.08
236 0.07
237 0.06
238 0.07
239 0.07
240 0.09
241 0.1
242 0.11
243 0.15
244 0.18
245 0.19
246 0.2
247 0.22
248 0.22
249 0.29
250 0.29
251 0.26
252 0.23
253 0.22
254 0.2
255 0.18
256 0.21
257 0.13
258 0.15
259 0.14
260 0.15
261 0.15
262 0.15
263 0.14
264 0.1
265 0.11
266 0.09
267 0.09
268 0.09
269 0.12
270 0.14
271 0.15
272 0.15
273 0.15
274 0.18
275 0.17
276 0.17
277 0.17
278 0.18
279 0.17
280 0.17
281 0.18
282 0.14
283 0.13
284 0.12
285 0.11
286 0.08
287 0.08
288 0.07
289 0.07
290 0.09
291 0.09
292 0.09
293 0.08
294 0.08
295 0.07
296 0.08
297 0.07
298 0.06
299 0.06
300 0.06
301 0.07
302 0.07
303 0.08
304 0.08
305 0.11
306 0.13
307 0.13
308 0.14
309 0.18
310 0.18
311 0.17
312 0.18
313 0.18
314 0.18
315 0.21
316 0.24
317 0.23
318 0.25
319 0.26
320 0.35
321 0.38
322 0.37
323 0.36
324 0.36
325 0.35
326 0.33
327 0.36
328 0.27
329 0.22
330 0.22
331 0.2
332 0.19
333 0.19
334 0.2
335 0.18
336 0.19
337 0.19
338 0.2
339 0.26
340 0.3
341 0.33
342 0.34
343 0.35
344 0.33
345 0.33
346 0.35
347 0.32
348 0.31
349 0.29
350 0.29
351 0.29
352 0.31
353 0.31
354 0.28
355 0.27
356 0.23
357 0.22
358 0.21
359 0.2
360 0.22
361 0.27