Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4R932

Protein Details
Accession C4R932   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
181-201EGLSHNLSRRHKKSRPHEGSGBasic
NLS Segment(s)
PositionSequence
187-211LSRRHKKSRPHEGSGEPDTPKKRVM
Subcellular Location(s) nucl 23.5, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR006735  Rtf2  
Gene Ontology GO:0005634  C:nucleus  
GO:1902979  P:mitotic DNA replication termination  
GO:0071171  P:site-specific DNA replication termination at RTS1 barrier  
KEGG ppa:PAS_chr4_0837  -  
Pfam View protein in Pfam  
PF04641  Rtf2  
Amino Acid Sequences MGNDGGSIPKRRELLRINESEAQVNRSKLSVKLDSWYYCSISEEPLRYSEGTIVSDYRGRLYNKESVLKHLISKNKDLPHLKSLKDLVELRFCFKDGKISCPINKDIILDLDGKNDIPAFVYLVPCGCVVSGKIAKEITKLKSKPILCPVCNQPFEHTNVIPINPSNTTDLESRMARLRREGLSHNLSRRHKKSRPHEGSGEPDTPKKRVMKAEKDAKLICLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.53
3 0.55
4 0.56
5 0.58
6 0.58
7 0.55
8 0.49
9 0.44
10 0.39
11 0.35
12 0.3
13 0.26
14 0.27
15 0.25
16 0.3
17 0.3
18 0.27
19 0.3
20 0.35
21 0.35
22 0.37
23 0.36
24 0.31
25 0.26
26 0.28
27 0.24
28 0.24
29 0.26
30 0.24
31 0.23
32 0.23
33 0.25
34 0.22
35 0.22
36 0.2
37 0.17
38 0.16
39 0.16
40 0.15
41 0.14
42 0.16
43 0.16
44 0.15
45 0.19
46 0.19
47 0.21
48 0.24
49 0.29
50 0.3
51 0.37
52 0.35
53 0.36
54 0.39
55 0.37
56 0.38
57 0.37
58 0.4
59 0.36
60 0.41
61 0.42
62 0.41
63 0.47
64 0.46
65 0.45
66 0.47
67 0.49
68 0.44
69 0.41
70 0.4
71 0.34
72 0.35
73 0.33
74 0.26
75 0.29
76 0.29
77 0.28
78 0.27
79 0.26
80 0.23
81 0.2
82 0.27
83 0.2
84 0.24
85 0.28
86 0.31
87 0.32
88 0.35
89 0.36
90 0.29
91 0.29
92 0.24
93 0.18
94 0.16
95 0.15
96 0.13
97 0.12
98 0.11
99 0.1
100 0.09
101 0.09
102 0.08
103 0.06
104 0.05
105 0.05
106 0.05
107 0.06
108 0.06
109 0.06
110 0.06
111 0.07
112 0.07
113 0.07
114 0.05
115 0.05
116 0.05
117 0.11
118 0.13
119 0.13
120 0.15
121 0.16
122 0.16
123 0.2
124 0.25
125 0.23
126 0.3
127 0.3
128 0.32
129 0.39
130 0.4
131 0.42
132 0.47
133 0.51
134 0.43
135 0.48
136 0.52
137 0.53
138 0.53
139 0.49
140 0.42
141 0.37
142 0.41
143 0.39
144 0.31
145 0.27
146 0.26
147 0.25
148 0.23
149 0.2
150 0.18
151 0.15
152 0.17
153 0.15
154 0.14
155 0.16
156 0.16
157 0.18
158 0.19
159 0.19
160 0.19
161 0.24
162 0.27
163 0.26
164 0.29
165 0.32
166 0.31
167 0.34
168 0.36
169 0.37
170 0.42
171 0.46
172 0.49
173 0.53
174 0.58
175 0.64
176 0.68
177 0.7
178 0.69
179 0.73
180 0.78
181 0.81
182 0.82
183 0.79
184 0.78
185 0.74
186 0.74
187 0.7
188 0.65
189 0.56
190 0.54
191 0.5
192 0.46
193 0.46
194 0.44
195 0.44
196 0.49
197 0.57
198 0.61
199 0.68
200 0.76
201 0.75
202 0.77
203 0.72