Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4T0FLB3

Protein Details
Accession A0A4T0FLB3    Localization Confidence Low Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
113-132LPSLKARQIKVLRRPQPKESHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR012340  NA-bd_OB-fold  
IPR000424  Primosome_PriB/ssb  
IPR011344  ssDNA-bd  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0003697  F:single-stranded DNA binding  
GO:0006260  P:DNA replication  
Pfam View protein in Pfam  
PF00436  SSB  
PROSITE View protein in PROSITE  
PS50935  SSB  
CDD cd04496  SSB_OBF  
Amino Acid Sequences MLSRIIPKIQPALGARAASTFAKLTLCGNIAEPEFKTAKNGNEYARLSVATTASLPPAEDGQPQEETNWHSVYVFGERAEALRSAKKGSLVYVEADYTLQKVQQDDNSPIYKLPSLKARQIKVLRRPQPKESAEGSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.27
3 0.23
4 0.25
5 0.19
6 0.19
7 0.14
8 0.11
9 0.11
10 0.12
11 0.12
12 0.12
13 0.13
14 0.12
15 0.13
16 0.14
17 0.14
18 0.16
19 0.15
20 0.16
21 0.16
22 0.16
23 0.19
24 0.2
25 0.23
26 0.26
27 0.29
28 0.27
29 0.33
30 0.34
31 0.32
32 0.29
33 0.25
34 0.21
35 0.19
36 0.17
37 0.1
38 0.09
39 0.08
40 0.08
41 0.08
42 0.07
43 0.06
44 0.07
45 0.08
46 0.08
47 0.09
48 0.11
49 0.12
50 0.13
51 0.12
52 0.13
53 0.14
54 0.14
55 0.14
56 0.12
57 0.1
58 0.1
59 0.11
60 0.11
61 0.1
62 0.08
63 0.08
64 0.08
65 0.08
66 0.09
67 0.09
68 0.09
69 0.11
70 0.12
71 0.13
72 0.14
73 0.16
74 0.16
75 0.16
76 0.17
77 0.16
78 0.16
79 0.15
80 0.15
81 0.12
82 0.12
83 0.11
84 0.09
85 0.09
86 0.08
87 0.09
88 0.1
89 0.12
90 0.17
91 0.22
92 0.24
93 0.29
94 0.3
95 0.29
96 0.28
97 0.28
98 0.26
99 0.23
100 0.23
101 0.27
102 0.3
103 0.38
104 0.45
105 0.45
106 0.52
107 0.6
108 0.66
109 0.67
110 0.73
111 0.74
112 0.77
113 0.81
114 0.79
115 0.8
116 0.73
117 0.69