Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4T0FQV8

Protein Details
Accession A0A4T0FQV8    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
94-125ESKVLKKIDKLQRAKKNATKKSKRKYASLSATHydrophilic
NLS Segment(s)
PositionSequence
99-118KKIDKLQRAKKNATKKSKRK
Subcellular Location(s) mito 21, nucl 5.5, cyto_nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000352  Pep_chain_release_fac_I  
IPR045853  Pep_chain_release_fac_I_sf  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0003747  F:translation release factor activity  
Pfam View protein in Pfam  
PF00472  RF-1  
Amino Acid Sequences MSLVRSIATSARAGVASTSTLLTKLREEDLLEKFVKGQGKGGQAVNKTSNKVYLLHTPTGLSVECHATRSLISNRSQARKLLQDKYDSVYNPSESKVLKKIDKLQRAKKNATKKSKRKYASLSATDFQEEKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.1
4 0.1
5 0.1
6 0.09
7 0.1
8 0.11
9 0.12
10 0.12
11 0.14
12 0.15
13 0.15
14 0.17
15 0.21
16 0.23
17 0.27
18 0.25
19 0.23
20 0.22
21 0.24
22 0.26
23 0.2
24 0.21
25 0.22
26 0.24
27 0.27
28 0.29
29 0.3
30 0.28
31 0.31
32 0.33
33 0.3
34 0.29
35 0.26
36 0.26
37 0.23
38 0.23
39 0.23
40 0.25
41 0.27
42 0.26
43 0.25
44 0.23
45 0.22
46 0.21
47 0.19
48 0.11
49 0.08
50 0.1
51 0.1
52 0.11
53 0.11
54 0.1
55 0.1
56 0.14
57 0.17
58 0.18
59 0.19
60 0.24
61 0.29
62 0.33
63 0.34
64 0.31
65 0.31
66 0.35
67 0.39
68 0.4
69 0.39
70 0.38
71 0.38
72 0.4
73 0.41
74 0.33
75 0.3
76 0.26
77 0.25
78 0.22
79 0.22
80 0.21
81 0.18
82 0.21
83 0.24
84 0.28
85 0.3
86 0.34
87 0.43
88 0.5
89 0.59
90 0.65
91 0.69
92 0.73
93 0.77
94 0.81
95 0.79
96 0.81
97 0.81
98 0.83
99 0.84
100 0.84
101 0.87
102 0.88
103 0.85
104 0.83
105 0.81
106 0.8
107 0.79
108 0.76
109 0.72
110 0.64
111 0.62
112 0.56