Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4U0TPL9

Protein Details
Accession A0A4U0TPL9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
17-36VSCRPRRRECDRPRVRIPARBasic
NLS Segment(s)
Subcellular Location(s) plas 12, mito 8, extr 3, cyto 2, E.R. 2
Family & Domain DBs
Amino Acid Sequences MIEALLLLGMIVASGIVSCRPRRRECDRPRVRIPARPVWCSNNEIVFLPLFYFLGMYLSRKVKKRQAPWLSYQAEASAGPLSELLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.02
2 0.03
3 0.05
4 0.09
5 0.15
6 0.23
7 0.3
8 0.36
9 0.44
10 0.53
11 0.61
12 0.68
13 0.75
14 0.77
15 0.78
16 0.79
17 0.81
18 0.76
19 0.71
20 0.68
21 0.66
22 0.6
23 0.56
24 0.53
25 0.47
26 0.46
27 0.41
28 0.36
29 0.27
30 0.23
31 0.19
32 0.17
33 0.13
34 0.1
35 0.08
36 0.07
37 0.06
38 0.05
39 0.05
40 0.04
41 0.06
42 0.06
43 0.07
44 0.11
45 0.17
46 0.22
47 0.28
48 0.34
49 0.42
50 0.5
51 0.57
52 0.64
53 0.69
54 0.7
55 0.72
56 0.75
57 0.68
58 0.6
59 0.52
60 0.42
61 0.33
62 0.27
63 0.21
64 0.13
65 0.1
66 0.1