Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4U0V5Q7

Protein Details
Accession A0A4U0V5Q7    Localization Confidence High Confidence Score 16.1
NoLS Segment(s)
PositionSequenceProtein Nature
206-231DEILNQKAAKQDKKKKEQHKLDKAEAHydrophilic
NLS Segment(s)
PositionSequence
100-105AQARKK
119-125LKPLEKR
197-200KKRK
214-225AKQDKKKKEQHK
Subcellular Location(s) nucl 21, mito_nucl 13.333, cyto_nucl 11.833, mito 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR021641  DUF3245  
Pfam View protein in Pfam  
PF11595  DUF3245  
Amino Acid Sequences MATSQELADIIFNRQAVALARSRRLVQSWLPPKPTTDDAELPDQQPAAEEEDDDWEGMTELQGVGSKRKAEDEGVLDGLKRKKLSSDNKLLELLLGKKAAQARKKTLETSRYGGRAAALKPLEKRGIVPKHRDVSEDEEEGRASSFKSRKSKAKPAVVELEPEVDRPEDPVPDEDGMGAKQQVQALSARVEAHPPAKKRKGGSYLDEILNQKAAKQDKKKKEQHKLDKAEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.15
3 0.15
4 0.18
5 0.22
6 0.24
7 0.27
8 0.3
9 0.32
10 0.33
11 0.33
12 0.34
13 0.32
14 0.38
15 0.45
16 0.49
17 0.52
18 0.5
19 0.5
20 0.51
21 0.49
22 0.42
23 0.38
24 0.36
25 0.34
26 0.4
27 0.4
28 0.35
29 0.32
30 0.28
31 0.22
32 0.19
33 0.17
34 0.14
35 0.12
36 0.12
37 0.11
38 0.15
39 0.15
40 0.14
41 0.13
42 0.09
43 0.09
44 0.08
45 0.08
46 0.05
47 0.04
48 0.05
49 0.08
50 0.08
51 0.11
52 0.13
53 0.15
54 0.15
55 0.17
56 0.18
57 0.17
58 0.2
59 0.2
60 0.2
61 0.2
62 0.19
63 0.18
64 0.21
65 0.23
66 0.22
67 0.2
68 0.17
69 0.21
70 0.3
71 0.39
72 0.43
73 0.5
74 0.5
75 0.52
76 0.52
77 0.47
78 0.39
79 0.31
80 0.24
81 0.15
82 0.13
83 0.11
84 0.12
85 0.17
86 0.21
87 0.25
88 0.28
89 0.33
90 0.39
91 0.42
92 0.43
93 0.45
94 0.45
95 0.43
96 0.42
97 0.39
98 0.33
99 0.31
100 0.27
101 0.23
102 0.2
103 0.17
104 0.19
105 0.16
106 0.17
107 0.18
108 0.21
109 0.21
110 0.18
111 0.19
112 0.23
113 0.32
114 0.35
115 0.4
116 0.44
117 0.48
118 0.48
119 0.48
120 0.42
121 0.4
122 0.38
123 0.33
124 0.27
125 0.22
126 0.22
127 0.21
128 0.18
129 0.11
130 0.08
131 0.13
132 0.16
133 0.23
134 0.31
135 0.36
136 0.45
137 0.53
138 0.63
139 0.65
140 0.71
141 0.67
142 0.64
143 0.66
144 0.57
145 0.51
146 0.41
147 0.35
148 0.26
149 0.24
150 0.2
151 0.13
152 0.12
153 0.13
154 0.14
155 0.11
156 0.12
157 0.14
158 0.16
159 0.16
160 0.16
161 0.13
162 0.13
163 0.13
164 0.12
165 0.11
166 0.09
167 0.11
168 0.12
169 0.12
170 0.12
171 0.13
172 0.14
173 0.15
174 0.15
175 0.15
176 0.13
177 0.15
178 0.16
179 0.22
180 0.27
181 0.32
182 0.41
183 0.47
184 0.52
185 0.54
186 0.61
187 0.63
188 0.63
189 0.63
190 0.61
191 0.59
192 0.56
193 0.57
194 0.49
195 0.41
196 0.39
197 0.33
198 0.26
199 0.27
200 0.33
201 0.38
202 0.47
203 0.56
204 0.63
205 0.74
206 0.83
207 0.87
208 0.91
209 0.92
210 0.93
211 0.93