Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4U0TWH7

Protein Details
Accession A0A4U0TWH7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
52-75YISCTYFHRRKKVKKGRWPGGPKSHydrophilic
NLS Segment(s)
PositionSequence
60-73RRKKVKKGRWPGGP
Subcellular Location(s) plas 11, extr 6, mito 4, E.R. 3, vacu 2, cyto_mito 2, mito_nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR000612  PMP3  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF01679  Pmp3  
Amino Acid Sequences MRALAYRASLTVINIFFPPLAVAMLCGWEWDCMLNCVLFLLAVIPSHVHGFYISCTYFHRRKKVKKGRWPGGPKSLIHSDNVINGGASDAEAARLWRKENGLEEKHDWRSRHNGVKRIDSQHL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.16
3 0.13
4 0.13
5 0.12
6 0.07
7 0.07
8 0.06
9 0.07
10 0.06
11 0.07
12 0.07
13 0.07
14 0.07
15 0.07
16 0.07
17 0.08
18 0.08
19 0.08
20 0.09
21 0.09
22 0.08
23 0.08
24 0.07
25 0.06
26 0.05
27 0.04
28 0.04
29 0.04
30 0.04
31 0.04
32 0.05
33 0.06
34 0.06
35 0.05
36 0.05
37 0.06
38 0.06
39 0.09
40 0.09
41 0.09
42 0.11
43 0.17
44 0.24
45 0.29
46 0.38
47 0.43
48 0.52
49 0.63
50 0.72
51 0.77
52 0.8
53 0.86
54 0.85
55 0.86
56 0.85
57 0.8
58 0.78
59 0.71
60 0.6
61 0.55
62 0.52
63 0.43
64 0.35
65 0.32
66 0.23
67 0.21
68 0.22
69 0.17
70 0.11
71 0.1
72 0.09
73 0.07
74 0.06
75 0.05
76 0.04
77 0.05
78 0.05
79 0.06
80 0.1
81 0.11
82 0.13
83 0.16
84 0.18
85 0.2
86 0.28
87 0.36
88 0.37
89 0.41
90 0.44
91 0.48
92 0.56
93 0.58
94 0.52
95 0.48
96 0.53
97 0.56
98 0.62
99 0.62
100 0.62
101 0.62
102 0.7
103 0.73