Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E2M081

Protein Details
Accession E2M081    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
101-129RKANREEKLKANKEKKRAEKAARKAEKAKBasic
NLS Segment(s)
PositionSequence
43-132RKNPRRIAWTVLFRKHHKKGITEEVAKKRSRKTVKAQRPITGASLDLIKERRSLKPEVRKANREEKLKANKEKKRAEKAARKAEKAKSAG
Subcellular Location(s) nucl 16.5, mito_nucl 12, mito 6.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR038630  L24e/L24_sf  
IPR000988  Ribosomal_L24e-rel  
IPR023442  Ribosomal_L24e_CS  
KEGG mpr:MPER_13049  -  
Pfam View protein in Pfam  
PF01246  Ribosomal_L24e  
PROSITE View protein in PROSITE  
PS01073  RIBOSOMAL_L24E  
CDD cd00472  Ribosomal_L24e_L24  
Amino Acid Sequences MKVEVDSFSGAKIYPGRGTLFVRGDSKIFRFQNSKSASLFKQRKNPRRIAWTVLFRKHHKKGITEEVAKKRSRKTVKAQRPITGASLDLIKERRSLKPEVRKANREEKLKANKEKKRAEKAARKAEKAKSAGVQGSKVSKQQAKGAFQKVAATSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.18
3 0.2
4 0.23
5 0.26
6 0.29
7 0.29
8 0.29
9 0.3
10 0.28
11 0.28
12 0.28
13 0.29
14 0.32
15 0.3
16 0.31
17 0.34
18 0.34
19 0.41
20 0.42
21 0.42
22 0.35
23 0.38
24 0.36
25 0.43
26 0.5
27 0.47
28 0.52
29 0.6
30 0.68
31 0.71
32 0.77
33 0.73
34 0.74
35 0.72
36 0.69
37 0.65
38 0.65
39 0.64
40 0.63
41 0.61
42 0.58
43 0.63
44 0.62
45 0.61
46 0.54
47 0.51
48 0.5
49 0.54
50 0.56
51 0.54
52 0.56
53 0.58
54 0.6
55 0.59
56 0.56
57 0.5
58 0.52
59 0.52
60 0.5
61 0.53
62 0.59
63 0.66
64 0.73
65 0.72
66 0.67
67 0.62
68 0.57
69 0.47
70 0.37
71 0.26
72 0.17
73 0.15
74 0.11
75 0.11
76 0.11
77 0.1
78 0.14
79 0.16
80 0.19
81 0.22
82 0.27
83 0.34
84 0.43
85 0.51
86 0.58
87 0.63
88 0.66
89 0.68
90 0.73
91 0.71
92 0.66
93 0.62
94 0.61
95 0.64
96 0.66
97 0.71
98 0.7
99 0.7
100 0.74
101 0.8
102 0.8
103 0.8
104 0.81
105 0.81
106 0.81
107 0.85
108 0.86
109 0.84
110 0.8
111 0.77
112 0.75
113 0.72
114 0.65
115 0.58
116 0.5
117 0.47
118 0.47
119 0.41
120 0.36
121 0.31
122 0.35
123 0.33
124 0.33
125 0.36
126 0.36
127 0.36
128 0.42
129 0.46
130 0.48
131 0.54
132 0.57
133 0.53
134 0.49
135 0.51