Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4U0UTI3

Protein Details
Accession A0A4U0UTI3    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
7-30TAPATHKQPSRKGKKAWRKNVDISHydrophilic
NLS Segment(s)
PositionSequence
15-24PSRKGKKAWR
Subcellular Location(s) mito 13, cyto 9, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR011687  Nop53/GLTSCR2  
Gene Ontology GO:0005730  C:nucleolus  
GO:0005654  C:nucleoplasm  
GO:0042254  P:ribosome biogenesis  
Pfam View protein in Pfam  
PF07767  Nop53  
Amino Acid Sequences MAPATVTAPATHKQPSRKGKKAWRKNVDISAVQTGLEEVRDEIVKHGGVVAEKDADQLFATDLT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.51
3 0.58
4 0.65
5 0.72
6 0.76
7 0.83
8 0.87
9 0.88
10 0.86
11 0.82
12 0.79
13 0.76
14 0.69
15 0.6
16 0.51
17 0.42
18 0.33
19 0.26
20 0.2
21 0.14
22 0.1
23 0.08
24 0.06
25 0.04
26 0.05
27 0.06
28 0.06
29 0.08
30 0.1
31 0.09
32 0.09
33 0.1
34 0.1
35 0.1
36 0.11
37 0.11
38 0.1
39 0.1
40 0.12
41 0.12
42 0.11
43 0.11
44 0.1