Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4U0UX17

Protein Details
Accession A0A4U0UX17    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
26-50AIPRSEAKRPKTKKATPTKSQHFQAHydrophilic
94-115GENEPKQRKKPAPRKTARTPGABasic
NLS Segment(s)
PositionSequence
19-40KRIASATAIPRSEAKRPKTKKA
99-111KQRKKPAPRKTAR
Subcellular Location(s) nucl 14, mito_nucl 12.833, mito 10.5, cyto_nucl 8.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR012808  CHP02453  
Amino Acid Sequences MARKSERLSTGTRPGAAHKRIASATAIPRSEAKRPKTKKATPTKSQHFQADEDAEDEEGEQSSGDDDVDSAFDDVGDASSSEAGPADDDFDSGGENEPKQRKKPAPRKTARTPGAAPAHEGQETSLEPGTQLIIRKPKARPAGKTPYNDSTIHPNTLLFLKDLAANNNREVRLKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.51
3 0.49
4 0.48
5 0.4
6 0.41
7 0.39
8 0.4
9 0.34
10 0.31
11 0.34
12 0.35
13 0.34
14 0.3
15 0.34
16 0.36
17 0.43
18 0.45
19 0.45
20 0.5
21 0.56
22 0.65
23 0.71
24 0.76
25 0.77
26 0.81
27 0.83
28 0.82
29 0.86
30 0.84
31 0.82
32 0.78
33 0.73
34 0.64
35 0.56
36 0.5
37 0.42
38 0.33
39 0.26
40 0.22
41 0.16
42 0.14
43 0.12
44 0.08
45 0.06
46 0.05
47 0.04
48 0.04
49 0.04
50 0.05
51 0.04
52 0.04
53 0.04
54 0.04
55 0.04
56 0.04
57 0.04
58 0.04
59 0.04
60 0.04
61 0.04
62 0.04
63 0.04
64 0.03
65 0.03
66 0.04
67 0.04
68 0.04
69 0.04
70 0.04
71 0.04
72 0.04
73 0.05
74 0.05
75 0.05
76 0.05
77 0.05
78 0.05
79 0.05
80 0.07
81 0.06
82 0.06
83 0.12
84 0.19
85 0.22
86 0.25
87 0.33
88 0.4
89 0.5
90 0.6
91 0.65
92 0.7
93 0.75
94 0.81
95 0.82
96 0.84
97 0.77
98 0.72
99 0.63
100 0.6
101 0.57
102 0.48
103 0.42
104 0.33
105 0.31
106 0.26
107 0.25
108 0.17
109 0.13
110 0.13
111 0.12
112 0.11
113 0.09
114 0.09
115 0.09
116 0.1
117 0.1
118 0.11
119 0.14
120 0.22
121 0.25
122 0.31
123 0.34
124 0.41
125 0.49
126 0.54
127 0.56
128 0.57
129 0.65
130 0.66
131 0.69
132 0.67
133 0.63
134 0.6
135 0.55
136 0.48
137 0.47
138 0.43
139 0.4
140 0.34
141 0.28
142 0.26
143 0.27
144 0.26
145 0.17
146 0.14
147 0.13
148 0.17
149 0.19
150 0.24
151 0.27
152 0.28
153 0.32
154 0.38
155 0.39