Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4U0V7R9

Protein Details
Accession A0A4U0V7R9    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
52-78KAEAKKTKSKAPKKRVAKKKAAKEGAABasic
NLS Segment(s)
PositionSequence
52-84KAEAKKTKSKAPKKRVAKKKAAKEGAAKKVAAK
Subcellular Location(s) mito 11.5, nucl 10.5, cyto_mito 8.833, cyto_nucl 8.333, cyto 5
Family & Domain DBs
Amino Acid Sequences MAPKGLLAIVRKSGHYRPFAEPYAHPGSAWDLQTKKDQEVRRQRLEEQANEKAEAKKTKSKAPKKRVAKKKAAKEGAAKKVAAKEVAKEEVPVEEGEANASPAYYGRMVRMR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.42
3 0.43
4 0.43
5 0.47
6 0.48
7 0.47
8 0.41
9 0.42
10 0.43
11 0.38
12 0.32
13 0.26
14 0.28
15 0.28
16 0.28
17 0.26
18 0.2
19 0.22
20 0.29
21 0.3
22 0.29
23 0.32
24 0.36
25 0.42
26 0.52
27 0.58
28 0.59
29 0.6
30 0.58
31 0.6
32 0.59
33 0.55
34 0.5
35 0.48
36 0.41
37 0.39
38 0.4
39 0.33
40 0.33
41 0.31
42 0.29
43 0.3
44 0.31
45 0.38
46 0.46
47 0.55
48 0.61
49 0.67
50 0.73
51 0.77
52 0.86
53 0.88
54 0.87
55 0.88
56 0.86
57 0.86
58 0.86
59 0.81
60 0.74
61 0.73
62 0.72
63 0.7
64 0.64
65 0.54
66 0.46
67 0.45
68 0.43
69 0.38
70 0.3
71 0.25
72 0.27
73 0.3
74 0.28
75 0.24
76 0.23
77 0.19
78 0.2
79 0.16
80 0.13
81 0.1
82 0.1
83 0.11
84 0.11
85 0.11
86 0.09
87 0.09
88 0.07
89 0.07
90 0.1
91 0.11
92 0.11