Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4U0V513

Protein Details
Accession A0A4U0V513    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
72-95LVLTPEKKPKQARKSSKKGTTPVEHydrophilic
NLS Segment(s)
PositionSequence
78-89KKPKQARKSSKK
Subcellular Location(s) cyto 17.5, cyto_nucl 13.333, nucl 8, mito_nucl 4.833
Family & Domain DBs
Amino Acid Sequences MVQQLSVLFQIIEKAGTIPWDNIKLPADRTLLAAKKMINNEREKVTAMNNGEEPVSATKVANPEVYLPLLLLVLTPEKKPKQARKSSKKGTTPVESASAEDGGEEKVKAELADNEGFD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.11
4 0.12
5 0.13
6 0.16
7 0.19
8 0.19
9 0.22
10 0.24
11 0.23
12 0.24
13 0.27
14 0.25
15 0.22
16 0.24
17 0.27
18 0.27
19 0.26
20 0.27
21 0.23
22 0.25
23 0.31
24 0.34
25 0.34
26 0.36
27 0.37
28 0.38
29 0.37
30 0.34
31 0.29
32 0.26
33 0.25
34 0.21
35 0.2
36 0.18
37 0.17
38 0.16
39 0.14
40 0.14
41 0.09
42 0.09
43 0.08
44 0.07
45 0.09
46 0.1
47 0.11
48 0.1
49 0.09
50 0.1
51 0.1
52 0.11
53 0.09
54 0.07
55 0.07
56 0.06
57 0.06
58 0.04
59 0.04
60 0.06
61 0.08
62 0.08
63 0.15
64 0.16
65 0.23
66 0.32
67 0.42
68 0.5
69 0.6
70 0.7
71 0.75
72 0.84
73 0.88
74 0.89
75 0.86
76 0.82
77 0.78
78 0.73
79 0.65
80 0.57
81 0.51
82 0.42
83 0.36
84 0.31
85 0.24
86 0.18
87 0.15
88 0.13
89 0.1
90 0.11
91 0.1
92 0.08
93 0.09
94 0.1
95 0.1
96 0.11
97 0.13
98 0.18