Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4U0VE07

Protein Details
Accession A0A4U0VE07    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MAPAAAGKKQKKKWSKGKVKDKANHAVIHydrophilic
NLS Segment(s)
PositionSequence
7-22GKKQKKKWSKGKVKDK
Subcellular Location(s) cyto 22, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPAAAGKKQKKKWSKGKVKDKANHAVILDKATGEKLAKDVQSYRLITVAVLVDRLKINGSLARTALADLEEKGTIKKVVAHSSGNIYTRAVGGGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.88
3 0.89
4 0.92
5 0.92
6 0.92
7 0.88
8 0.85
9 0.83
10 0.75
11 0.66
12 0.56
13 0.49
14 0.39
15 0.34
16 0.27
17 0.17
18 0.14
19 0.12
20 0.13
21 0.09
22 0.09
23 0.09
24 0.12
25 0.12
26 0.13
27 0.15
28 0.18
29 0.23
30 0.23
31 0.21
32 0.19
33 0.18
34 0.17
35 0.16
36 0.12
37 0.06
38 0.07
39 0.06
40 0.07
41 0.07
42 0.07
43 0.07
44 0.06
45 0.08
46 0.09
47 0.11
48 0.11
49 0.11
50 0.11
51 0.11
52 0.11
53 0.1
54 0.09
55 0.08
56 0.08
57 0.09
58 0.09
59 0.09
60 0.1
61 0.12
62 0.11
63 0.11
64 0.16
65 0.19
66 0.24
67 0.27
68 0.29
69 0.29
70 0.34
71 0.38
72 0.34
73 0.31
74 0.25
75 0.23
76 0.21