Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4U0V965

Protein Details
Accession A0A4U0V965    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
76-97AVSAKMRKPKARRKAGGKVGEGBasic
NLS Segment(s)
PositionSequence
78-93SAKMRKPKARRKAGGK
Subcellular Location(s) mito 19, nucl 6, cyto_nucl 4.5
Family & Domain DBs
Amino Acid Sequences MPKASSTPVNHSKPCTLCHTPRDVLIRCQIDSTCVWHFVCPGSCWKSVSGGVVDGDGDEAHKWYRYGGMWKNKHEAVSAKMRKPKARRKAGGKVGEGSEGLAVKGGEDSEVSGGEGPGRDGEGHEVEPSREEGVET
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.52
3 0.5
4 0.5
5 0.53
6 0.56
7 0.5
8 0.52
9 0.57
10 0.51
11 0.48
12 0.49
13 0.46
14 0.38
15 0.39
16 0.34
17 0.28
18 0.26
19 0.26
20 0.2
21 0.2
22 0.2
23 0.18
24 0.19
25 0.19
26 0.2
27 0.17
28 0.22
29 0.23
30 0.24
31 0.25
32 0.25
33 0.25
34 0.23
35 0.23
36 0.17
37 0.14
38 0.12
39 0.11
40 0.1
41 0.07
42 0.07
43 0.05
44 0.05
45 0.04
46 0.04
47 0.05
48 0.06
49 0.06
50 0.06
51 0.08
52 0.09
53 0.15
54 0.21
55 0.31
56 0.35
57 0.38
58 0.42
59 0.41
60 0.4
61 0.35
62 0.31
63 0.25
64 0.31
65 0.34
66 0.35
67 0.4
68 0.44
69 0.5
70 0.57
71 0.64
72 0.63
73 0.68
74 0.71
75 0.74
76 0.8
77 0.82
78 0.8
79 0.72
80 0.65
81 0.55
82 0.48
83 0.39
84 0.29
85 0.21
86 0.13
87 0.11
88 0.09
89 0.07
90 0.06
91 0.07
92 0.06
93 0.05
94 0.05
95 0.06
96 0.06
97 0.06
98 0.06
99 0.06
100 0.07
101 0.08
102 0.08
103 0.08
104 0.08
105 0.08
106 0.08
107 0.09
108 0.13
109 0.14
110 0.15
111 0.17
112 0.18
113 0.17
114 0.19
115 0.2
116 0.17