Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4U0VDP7

Protein Details
Accession A0A4U0VDP7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
77-112EKTVRAKKPMKKVPGSRAPGREKRMQRRKEERQGRVBasic
NLS Segment(s)
PositionSequence
80-112VRAKKPMKKVPGSRAPGREKRMQRRKEERQGRV
Subcellular Location(s) mito 9, E.R. 6, plas 5, extr 5, mito_nucl 5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSLQTTQTCNSVVAIVVKIFGTFFFLLAALTAFEPEYRLTATGPLMAVGGLLFALPYTGLFERFMAAADSERISSAEKTVRAKKPMKKVPGSRAPGREKRMQRRKEERQGRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.12
3 0.11
4 0.11
5 0.1
6 0.09
7 0.08
8 0.11
9 0.09
10 0.09
11 0.09
12 0.09
13 0.09
14 0.09
15 0.09
16 0.05
17 0.05
18 0.05
19 0.05
20 0.05
21 0.06
22 0.06
23 0.07
24 0.07
25 0.07
26 0.07
27 0.09
28 0.09
29 0.09
30 0.09
31 0.08
32 0.07
33 0.06
34 0.06
35 0.04
36 0.04
37 0.02
38 0.02
39 0.02
40 0.02
41 0.02
42 0.02
43 0.02
44 0.04
45 0.04
46 0.05
47 0.06
48 0.06
49 0.07
50 0.07
51 0.08
52 0.06
53 0.06
54 0.06
55 0.07
56 0.07
57 0.07
58 0.07
59 0.08
60 0.09
61 0.09
62 0.11
63 0.14
64 0.17
65 0.22
66 0.31
67 0.37
68 0.43
69 0.51
70 0.56
71 0.63
72 0.69
73 0.73
74 0.73
75 0.76
76 0.78
77 0.8
78 0.8
79 0.76
80 0.77
81 0.77
82 0.76
83 0.73
84 0.73
85 0.73
86 0.77
87 0.8
88 0.8
89 0.81
90 0.84
91 0.89
92 0.9