Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4U0VKF6

Protein Details
Accession A0A4U0VKF6    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MAARRNKKAAAPKKPPTPRGSPHydrophilic
NLS Segment(s)
PositionSequence
4-47RRNKKAAAPKKPPTPRGSPQLSKVTKSKKAPSEDGSNAKKKIKR
140-155PAKKGGRKSKAAAPRA
Subcellular Location(s) mito 12, nucl 10, cyto 5
Family & Domain DBs
Amino Acid Sequences MAARRNKKAAAPKKPPTPRGSPQLSKVTKSKKAPSEDGSNAKKKIKRWTVAELTLLHEARQKETPYAQIIKDLHHTHTELACRLRMCGDKKKFLAEEAEERRRNKQDLAYITIFGSGAVQANFDYAAQGPKMPRSYYQPPAKKGGRKSKAAAPRALLPKPESPVLAPVQPQHQAMNTSGFDCLALAAEQAQRAELEGAAILAGMSGMMLAPQMTYAGVRQASIAQRGSLSHILN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.86
3 0.81
4 0.8
5 0.77
6 0.76
7 0.76
8 0.71
9 0.68
10 0.71
11 0.68
12 0.63
13 0.63
14 0.63
15 0.62
16 0.64
17 0.66
18 0.64
19 0.68
20 0.7
21 0.67
22 0.66
23 0.65
24 0.66
25 0.65
26 0.64
27 0.61
28 0.61
29 0.6
30 0.56
31 0.6
32 0.61
33 0.6
34 0.59
35 0.64
36 0.65
37 0.64
38 0.62
39 0.52
40 0.45
41 0.44
42 0.38
43 0.29
44 0.26
45 0.23
46 0.23
47 0.26
48 0.25
49 0.22
50 0.24
51 0.27
52 0.28
53 0.31
54 0.28
55 0.29
56 0.29
57 0.28
58 0.33
59 0.31
60 0.28
61 0.26
62 0.27
63 0.23
64 0.25
65 0.26
66 0.22
67 0.22
68 0.22
69 0.2
70 0.2
71 0.21
72 0.24
73 0.27
74 0.34
75 0.38
76 0.43
77 0.43
78 0.47
79 0.44
80 0.4
81 0.38
82 0.31
83 0.34
84 0.35
85 0.43
86 0.43
87 0.44
88 0.47
89 0.47
90 0.46
91 0.4
92 0.36
93 0.33
94 0.32
95 0.37
96 0.32
97 0.29
98 0.28
99 0.25
100 0.21
101 0.15
102 0.11
103 0.05
104 0.05
105 0.05
106 0.05
107 0.04
108 0.05
109 0.05
110 0.04
111 0.05
112 0.04
113 0.05
114 0.05
115 0.07
116 0.08
117 0.11
118 0.13
119 0.14
120 0.15
121 0.21
122 0.27
123 0.35
124 0.44
125 0.47
126 0.48
127 0.55
128 0.6
129 0.58
130 0.61
131 0.63
132 0.6
133 0.59
134 0.59
135 0.6
136 0.63
137 0.61
138 0.55
139 0.46
140 0.47
141 0.48
142 0.46
143 0.4
144 0.35
145 0.33
146 0.33
147 0.32
148 0.25
149 0.2
150 0.23
151 0.22
152 0.21
153 0.19
154 0.18
155 0.2
156 0.22
157 0.22
158 0.19
159 0.19
160 0.19
161 0.19
162 0.22
163 0.19
164 0.17
165 0.17
166 0.15
167 0.14
168 0.11
169 0.1
170 0.06
171 0.06
172 0.05
173 0.07
174 0.08
175 0.1
176 0.1
177 0.1
178 0.09
179 0.1
180 0.11
181 0.08
182 0.07
183 0.06
184 0.06
185 0.05
186 0.05
187 0.04
188 0.03
189 0.03
190 0.02
191 0.02
192 0.02
193 0.02
194 0.02
195 0.02
196 0.03
197 0.03
198 0.03
199 0.04
200 0.04
201 0.05
202 0.06
203 0.11
204 0.11
205 0.11
206 0.12
207 0.17
208 0.21
209 0.26
210 0.26
211 0.22
212 0.23
213 0.24
214 0.29