Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4U0V504

Protein Details
Accession A0A4U0V504    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
75-96MIRSNRKKAMKARQKEAGKKRSBasic
NLS Segment(s)
PositionSequence
79-96NRKKAMKARQKEAGKKRS
Subcellular Location(s) plas 21, E.R. 3, mito 1, golg 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR009914  DPM2  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0030234  F:enzyme regulator activity  
GO:0019348  P:dolichol metabolic process  
GO:0006486  P:protein glycosylation  
Pfam View protein in Pfam  
PF07297  DPM2  
Amino Acid Sequences MSNNNTLDKLVGASMLVVASAVFLYYTIWTLLLPFVDPTHPVQSLFPPRVWAIRIPVILLLLGGAVVGSFLSVVMIRSNRKKAMKARQKEAGKKRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.06
3 0.05
4 0.04
5 0.04
6 0.04
7 0.03
8 0.03
9 0.03
10 0.03
11 0.04
12 0.04
13 0.05
14 0.05
15 0.05
16 0.05
17 0.06
18 0.06
19 0.06
20 0.06
21 0.06
22 0.06
23 0.07
24 0.08
25 0.1
26 0.13
27 0.13
28 0.13
29 0.13
30 0.18
31 0.23
32 0.24
33 0.21
34 0.2
35 0.2
36 0.21
37 0.21
38 0.17
39 0.15
40 0.17
41 0.17
42 0.15
43 0.15
44 0.14
45 0.12
46 0.11
47 0.07
48 0.03
49 0.03
50 0.03
51 0.02
52 0.02
53 0.02
54 0.02
55 0.02
56 0.02
57 0.02
58 0.02
59 0.03
60 0.04
61 0.07
62 0.1
63 0.16
64 0.23
65 0.29
66 0.36
67 0.4
68 0.47
69 0.54
70 0.63
71 0.68
72 0.71
73 0.73
74 0.76
75 0.81
76 0.84