Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4U0TK12

Protein Details
Accession A0A4U0TK12    Localization Confidence Low Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
344-365QELLARKEKYWAKRNLQHPPAAHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 13, nucl 7, pero 4, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR012340  NA-bd_OB-fold  
IPR028389  POT1  
IPR032042  POT1PC  
IPR011564  Telomer_end-bd_POT1/Cdc13  
Gene Ontology GO:0000781  C:chromosome, telomeric region  
GO:0005634  C:nucleus  
GO:0043047  F:single-stranded telomeric DNA binding  
GO:0000723  P:telomere maintenance  
Pfam View protein in Pfam  
PF02765  POT1  
PF16686  POT1PC  
Amino Acid Sequences MALPGGFVDLATAYKEPPGNFVSIIGVVVDIMQPIRSAKTGHWMFTFKLLDRRLQDSVNGSEGLIVRFFKESESNLPQVREHGDVVLLRSAKLMPVNGVPTIVSNYQTRTQVFPVASIPGPGYSIAYQGTNRLHFLGAPADTESLTLAAQAYVIQLKTEVRLPDAKTLPQAVGKKREGAPVGSAGPPEKKARHSTFGNKYQLVRETHHRKYADLCVQVVKKYFSQSGKCELYVTDYTENRDVWYYAPPEERNGEERDGDYFGHLANKAWPGPYGWLVLKINVMDPHRQFVNNKVDEGDFVLLKNVKMKIMAEGAKLEGDIWRDPDNPSKINVLKLLRQETPEIQELLARKEKYWAKRNLQHPPAAD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.17
3 0.17
4 0.21
5 0.22
6 0.22
7 0.22
8 0.22
9 0.2
10 0.17
11 0.17
12 0.12
13 0.1
14 0.08
15 0.08
16 0.07
17 0.06
18 0.06
19 0.06
20 0.06
21 0.08
22 0.1
23 0.11
24 0.12
25 0.13
26 0.23
27 0.26
28 0.28
29 0.31
30 0.32
31 0.31
32 0.38
33 0.41
34 0.33
35 0.38
36 0.37
37 0.39
38 0.4
39 0.45
40 0.39
41 0.37
42 0.37
43 0.34
44 0.34
45 0.31
46 0.27
47 0.21
48 0.21
49 0.22
50 0.19
51 0.16
52 0.14
53 0.12
54 0.13
55 0.14
56 0.12
57 0.14
58 0.16
59 0.22
60 0.28
61 0.31
62 0.33
63 0.34
64 0.33
65 0.32
66 0.33
67 0.27
68 0.22
69 0.18
70 0.17
71 0.17
72 0.18
73 0.2
74 0.17
75 0.14
76 0.15
77 0.14
78 0.14
79 0.14
80 0.13
81 0.11
82 0.13
83 0.15
84 0.14
85 0.14
86 0.13
87 0.12
88 0.14
89 0.13
90 0.13
91 0.12
92 0.16
93 0.19
94 0.22
95 0.23
96 0.22
97 0.23
98 0.26
99 0.25
100 0.23
101 0.2
102 0.2
103 0.18
104 0.16
105 0.15
106 0.1
107 0.11
108 0.1
109 0.1
110 0.07
111 0.08
112 0.08
113 0.09
114 0.09
115 0.12
116 0.15
117 0.15
118 0.15
119 0.15
120 0.14
121 0.13
122 0.14
123 0.13
124 0.11
125 0.1
126 0.1
127 0.1
128 0.1
129 0.1
130 0.08
131 0.06
132 0.06
133 0.05
134 0.04
135 0.04
136 0.04
137 0.04
138 0.04
139 0.05
140 0.05
141 0.05
142 0.06
143 0.06
144 0.07
145 0.11
146 0.1
147 0.11
148 0.16
149 0.17
150 0.23
151 0.25
152 0.24
153 0.22
154 0.23
155 0.22
156 0.22
157 0.26
158 0.23
159 0.29
160 0.3
161 0.33
162 0.33
163 0.36
164 0.32
165 0.28
166 0.25
167 0.2
168 0.21
169 0.17
170 0.16
171 0.13
172 0.13
173 0.14
174 0.16
175 0.16
176 0.18
177 0.25
178 0.29
179 0.33
180 0.37
181 0.44
182 0.49
183 0.56
184 0.57
185 0.51
186 0.48
187 0.45
188 0.46
189 0.39
190 0.33
191 0.35
192 0.38
193 0.4
194 0.46
195 0.44
196 0.39
197 0.4
198 0.45
199 0.42
200 0.35
201 0.32
202 0.31
203 0.32
204 0.33
205 0.3
206 0.24
207 0.19
208 0.2
209 0.25
210 0.25
211 0.28
212 0.29
213 0.35
214 0.35
215 0.34
216 0.32
217 0.27
218 0.27
219 0.24
220 0.25
221 0.22
222 0.21
223 0.23
224 0.25
225 0.25
226 0.2
227 0.2
228 0.17
229 0.13
230 0.17
231 0.16
232 0.17
233 0.22
234 0.21
235 0.23
236 0.24
237 0.25
238 0.24
239 0.26
240 0.25
241 0.21
242 0.21
243 0.2
244 0.2
245 0.18
246 0.15
247 0.12
248 0.1
249 0.13
250 0.12
251 0.11
252 0.13
253 0.16
254 0.16
255 0.16
256 0.16
257 0.14
258 0.17
259 0.18
260 0.18
261 0.16
262 0.2
263 0.2
264 0.2
265 0.2
266 0.18
267 0.19
268 0.2
269 0.22
270 0.24
271 0.24
272 0.27
273 0.28
274 0.3
275 0.29
276 0.33
277 0.41
278 0.36
279 0.36
280 0.34
281 0.32
282 0.3
283 0.32
284 0.25
285 0.15
286 0.13
287 0.16
288 0.16
289 0.16
290 0.21
291 0.19
292 0.18
293 0.19
294 0.2
295 0.19
296 0.24
297 0.27
298 0.23
299 0.24
300 0.24
301 0.22
302 0.22
303 0.18
304 0.14
305 0.14
306 0.14
307 0.16
308 0.18
309 0.19
310 0.22
311 0.3
312 0.34
313 0.33
314 0.33
315 0.38
316 0.37
317 0.4
318 0.44
319 0.39
320 0.39
321 0.45
322 0.48
323 0.44
324 0.44
325 0.45
326 0.43
327 0.43
328 0.42
329 0.35
330 0.3
331 0.3
332 0.3
333 0.32
334 0.36
335 0.32
336 0.28
337 0.36
338 0.43
339 0.5
340 0.58
341 0.61
342 0.64
343 0.71
344 0.8
345 0.82
346 0.82