Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4U0US09

Protein Details
Accession A0A4U0US09    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
166-209APAKKLKKAAPKKAALKKAAPKKAAAPKKGKKGKKAPTPEEDGEBasic
NLS Segment(s)
PositionSequence
121-201GEKASPKKRKAAAEPDSEKSGTEAASAKKSKRAAGKKTADEDDEAAPAKKLKKAAPKKAALKKAAPKKAAAPKKGKKGKKA
Subcellular Location(s) cyto_nucl 13.333, cyto 13, nucl 12.5, cyto_mito 7.333
Family & Domain DBs
Amino Acid Sequences MAAIKLTAPQYKLLGAVVDTMKASFDWKAIATKMRHADAKKARDAWYGVRDKLTATVGADKSKSIDLAPAQEELLGFVIETMSASIDWETVAGKTGFPTPKKARDSWYPIRKKFTTSAGDGEKASPKKRKAAAEPDSEKSGTEAASAKKSKRAAGKKTADEDDEAAPAKKLKKAAPKKAALKKAAPKKAAAPKKGKKGKKAPTPEEDGEKAEEEEEEEEIAYDRSDAADAGSEPEVEMAT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.13
3 0.17
4 0.15
5 0.15
6 0.14
7 0.13
8 0.13
9 0.12
10 0.14
11 0.1
12 0.1
13 0.11
14 0.12
15 0.15
16 0.17
17 0.24
18 0.24
19 0.31
20 0.35
21 0.37
22 0.42
23 0.4
24 0.48
25 0.5
26 0.56
27 0.55
28 0.54
29 0.53
30 0.51
31 0.53
32 0.49
33 0.49
34 0.47
35 0.42
36 0.39
37 0.37
38 0.33
39 0.33
40 0.28
41 0.19
42 0.15
43 0.21
44 0.21
45 0.23
46 0.23
47 0.2
48 0.2
49 0.2
50 0.19
51 0.12
52 0.14
53 0.13
54 0.16
55 0.17
56 0.16
57 0.15
58 0.15
59 0.14
60 0.12
61 0.11
62 0.07
63 0.05
64 0.05
65 0.05
66 0.04
67 0.04
68 0.03
69 0.03
70 0.03
71 0.04
72 0.04
73 0.04
74 0.04
75 0.04
76 0.05
77 0.04
78 0.06
79 0.06
80 0.06
81 0.07
82 0.13
83 0.17
84 0.18
85 0.26
86 0.29
87 0.38
88 0.42
89 0.43
90 0.42
91 0.46
92 0.54
93 0.55
94 0.61
95 0.61
96 0.6
97 0.65
98 0.61
99 0.57
100 0.51
101 0.47
102 0.41
103 0.34
104 0.35
105 0.3
106 0.31
107 0.27
108 0.26
109 0.24
110 0.23
111 0.26
112 0.28
113 0.28
114 0.34
115 0.39
116 0.43
117 0.44
118 0.52
119 0.54
120 0.57
121 0.59
122 0.54
123 0.51
124 0.46
125 0.39
126 0.29
127 0.23
128 0.14
129 0.11
130 0.12
131 0.11
132 0.18
133 0.21
134 0.21
135 0.26
136 0.28
137 0.31
138 0.38
139 0.45
140 0.46
141 0.54
142 0.6
143 0.6
144 0.63
145 0.61
146 0.52
147 0.45
148 0.39
149 0.3
150 0.23
151 0.19
152 0.15
153 0.13
154 0.15
155 0.16
156 0.17
157 0.2
158 0.25
159 0.34
160 0.44
161 0.55
162 0.61
163 0.67
164 0.75
165 0.8
166 0.82
167 0.76
168 0.74
169 0.73
170 0.74
171 0.73
172 0.65
173 0.58
174 0.59
175 0.64
176 0.65
177 0.64
178 0.65
179 0.65
180 0.74
181 0.82
182 0.8
183 0.8
184 0.82
185 0.83
186 0.83
187 0.85
188 0.82
189 0.8
190 0.81
191 0.74
192 0.7
193 0.62
194 0.54
195 0.46
196 0.39
197 0.32
198 0.24
199 0.2
200 0.15
201 0.14
202 0.12
203 0.1
204 0.09
205 0.09
206 0.09
207 0.09
208 0.08
209 0.07
210 0.06
211 0.07
212 0.07
213 0.07
214 0.06
215 0.09
216 0.09
217 0.12
218 0.13
219 0.12
220 0.12