FuNGI

A0A4U0VFG9

Protein Details

Accession

A0A4U0VFG9

Localization Confidence

Low

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
414-436	SGNASRRDSMRRRRDRVGVREKD	Basic

NLS Segment(s)

Subcellular Location(s)

plas 16, cyto 4, mito 3, E.R. 2

Family & Domain DBs

InterPro	View protein in InterPro IPR009617 Seipin
Gene Ontology	GO:0005789 C:endoplasmic reticulum membrane GO:0140042 P:lipid droplet formation GO:0006629 P:lipid metabolic process
Pfam	View protein in Pfam PF06775 Seipin

Amino Acid Sequences

MALSNGSAPKEPDDEPRDGLIALVKVHHAAFLLKPFHIVLSKTALRAYLTTFLAVATAIVLFGFAVTAYILFYWSYIPRIGFERTVHLQFDNVYSHDHAGASGVSERTHPHGVVTLWPDLVGAQRYDILVELHFPRTPSNTAEGNFMLLTTLHAPPSPPNSGAQPAIGVATSPGSDKVLASSRRPAILPYRSPLLDLSHTLTHLPLSLLFPLNAETSVLRIPMFEALEFPAKNWRAVPSTLRLEIQSEGQMQVYGAKVVFRARFAGLRWVMYNWWGLSGVVFIGGFWAVEMLAAGVAWGVIGLVLAGQAGSAGEDGTEGGGEATRRIKEEGEGEEDGGAGMSDTERTFPGVGGGPAVKYESELRIKKEEEEADEEMGVVVPEHEVKASQADAEDEEDEDADFFLDSGLGTSMESGNASRRDSMRRRRDRVGVREKD

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.37
2	0.37
3	0.38
4	0.35
5	0.31
6	0.3
7	0.24
8	0.2
9	0.17
10	0.15
11	0.14
12	0.15
13	0.15
14	0.15
15	0.12
16	0.12
17	0.14
18	0.21
19	0.23
20	0.21
21	0.23
22	0.23
23	0.24
24	0.25
25	0.24
26	0.19
27	0.24
28	0.27
29	0.26
30	0.27
31	0.26
32	0.24
33	0.24
34	0.24
35	0.22
36	0.2
37	0.19
38	0.18
39	0.17
40	0.16
41	0.14
42	0.11
43	0.05
44	0.04
45	0.04
46	0.04
47	0.04
48	0.03
49	0.03
50	0.03
51	0.03
52	0.03
53	0.03
54	0.03
55	0.04
56	0.04
57	0.05
58	0.05
59	0.05
60	0.07
61	0.09
62	0.11
63	0.12
64	0.13
65	0.14
66	0.18
67	0.2
68	0.22
69	0.22
70	0.27
71	0.29
72	0.31
73	0.31
74	0.28
75	0.26
76	0.23
77	0.24
78	0.2
79	0.16
80	0.16
81	0.16
82	0.17
83	0.17
84	0.16
85	0.13
86	0.11
87	0.11
88	0.09
89	0.11
90	0.1
91	0.1
92	0.11
93	0.12
94	0.16
95	0.19
96	0.17
97	0.15
98	0.18
99	0.18
100	0.22
101	0.23
102	0.2
103	0.17
104	0.17
105	0.17
106	0.14
107	0.15
108	0.12
109	0.09
110	0.08
111	0.09
112	0.1
113	0.1
114	0.1
115	0.09
116	0.07
117	0.1
118	0.11
119	0.13
120	0.13
121	0.14
122	0.15
123	0.17
124	0.19
125	0.19
126	0.21
127	0.22
128	0.22
129	0.24
130	0.23
131	0.2
132	0.18
133	0.16
134	0.12
135	0.09
136	0.09
137	0.09
138	0.09
139	0.08
140	0.09
141	0.1
142	0.12
143	0.17
144	0.18
145	0.16
146	0.16
147	0.18
148	0.21
149	0.2
150	0.18
151	0.13
152	0.11
153	0.11
154	0.09
155	0.07
156	0.05
157	0.05
158	0.05
159	0.05
160	0.05
161	0.06
162	0.06
163	0.06
164	0.08
165	0.14
166	0.16
167	0.18
168	0.23
169	0.24
170	0.25
171	0.26
172	0.25
173	0.26
174	0.3
175	0.31
176	0.27
177	0.29
178	0.27
179	0.28
180	0.27
181	0.22
182	0.17
183	0.16
184	0.16
185	0.14
186	0.14
187	0.13
188	0.13
189	0.1
190	0.09
191	0.08
192	0.06
193	0.06
194	0.08
195	0.08
196	0.08
197	0.08
198	0.09
199	0.09
200	0.08
201	0.07
202	0.06
203	0.06
204	0.07
205	0.07
206	0.06
207	0.05
208	0.06
209	0.07
210	0.08
211	0.07
212	0.07
213	0.08
214	0.11
215	0.11
216	0.11
217	0.17
218	0.17
219	0.18
220	0.18
221	0.19
222	0.18
223	0.2
224	0.22
225	0.21
226	0.23
227	0.24
228	0.24
229	0.21
230	0.2
231	0.19
232	0.18
233	0.14
234	0.12
235	0.11
236	0.11
237	0.1
238	0.09
239	0.1
240	0.08
241	0.07
242	0.06
243	0.06
244	0.07
245	0.11
246	0.12
247	0.11
248	0.12
249	0.13
250	0.15
251	0.15
252	0.23
253	0.2
254	0.21
255	0.21
256	0.2
257	0.19
258	0.18
259	0.19
260	0.11
261	0.11
262	0.1
263	0.09
264	0.08
265	0.08
266	0.06
267	0.05
268	0.05
269	0.04
270	0.04
271	0.04
272	0.04
273	0.03
274	0.03
275	0.03
276	0.03
277	0.03
278	0.02
279	0.02
280	0.02
281	0.02
282	0.02
283	0.02
284	0.02
285	0.02
286	0.02
287	0.02
288	0.02
289	0.02
290	0.02
291	0.02
292	0.02
293	0.02
294	0.02
295	0.02
296	0.02
297	0.02
298	0.03
299	0.03
300	0.03
301	0.03
302	0.03
303	0.03
304	0.03
305	0.03
306	0.03
307	0.04
308	0.05
309	0.07
310	0.1
311	0.11
312	0.13
313	0.15
314	0.15
315	0.16
316	0.2
317	0.22
318	0.24
319	0.24
320	0.22
321	0.21
322	0.2
323	0.18
324	0.13
325	0.1
326	0.04
327	0.04
328	0.03
329	0.05
330	0.05
331	0.06
332	0.07
333	0.09
334	0.09
335	0.09
336	0.11
337	0.12
338	0.12
339	0.13
340	0.13
341	0.12
342	0.12
343	0.13
344	0.1
345	0.1
346	0.13
347	0.17
348	0.25
349	0.29
350	0.33
351	0.38
352	0.39
353	0.4
354	0.45
355	0.42
356	0.38
357	0.4
358	0.38
359	0.33
360	0.32
361	0.29
362	0.22
363	0.19
364	0.14
365	0.08
366	0.06
367	0.05
368	0.06
369	0.07
370	0.07
371	0.07
372	0.08
373	0.1
374	0.1
375	0.1
376	0.1
377	0.11
378	0.12
379	0.14
380	0.14
381	0.12
382	0.12
383	0.12
384	0.11
385	0.1
386	0.09
387	0.07
388	0.06
389	0.05
390	0.05
391	0.05
392	0.05
393	0.05
394	0.06
395	0.06
396	0.06
397	0.07
398	0.08
399	0.08
400	0.09
401	0.09
402	0.15
403	0.18
404	0.21
405	0.24
406	0.28
407	0.38
408	0.47
409	0.58
410	0.62
411	0.7
412	0.75
413	0.78
414	0.85
415	0.85
416	0.86

A0A4U0VFG9

3D AlphaFold-predicted Structure Viewer