Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4U0U0W4

Protein Details
Accession A0A4U0U0W4    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
144-169AAPETKAVAKPKKKAKHIKLAFDDGGHydrophilic
NLS Segment(s)
PositionSequence
149-161KAVAKPKKKAKHI
Subcellular Location(s) cyto_nucl 12, nucl 11, cyto 11, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR027911  DUF4604  
Pfam View protein in Pfam  
PF15377  DUF4604  
Amino Acid Sequences MPAKIKAKDLSYDTSLPPFLQRLHDQKAGRGDTDRHERPLARPMRAKDSNDDDGPTVVDESGETVSKAEYEKLTAADAETADATAGGNMVDDTKGDDLEVLMSGALPVEDGKKVGVVATSGLVTKKRKAARIVGEADAEVVVKAAPETKAVAKPKKKAKHIKLAFDDGGEG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.34
3 0.29
4 0.27
5 0.24
6 0.21
7 0.24
8 0.29
9 0.33
10 0.39
11 0.45
12 0.44
13 0.46
14 0.53
15 0.49
16 0.43
17 0.4
18 0.36
19 0.37
20 0.46
21 0.44
22 0.39
23 0.41
24 0.41
25 0.4
26 0.47
27 0.45
28 0.42
29 0.45
30 0.45
31 0.5
32 0.54
33 0.54
34 0.5
35 0.51
36 0.5
37 0.44
38 0.42
39 0.33
40 0.27
41 0.25
42 0.2
43 0.13
44 0.08
45 0.07
46 0.05
47 0.06
48 0.07
49 0.06
50 0.06
51 0.06
52 0.06
53 0.07
54 0.07
55 0.08
56 0.07
57 0.08
58 0.09
59 0.09
60 0.09
61 0.09
62 0.08
63 0.08
64 0.07
65 0.06
66 0.05
67 0.05
68 0.04
69 0.04
70 0.04
71 0.03
72 0.03
73 0.02
74 0.02
75 0.02
76 0.03
77 0.03
78 0.03
79 0.04
80 0.05
81 0.05
82 0.05
83 0.05
84 0.04
85 0.05
86 0.05
87 0.04
88 0.03
89 0.03
90 0.03
91 0.03
92 0.03
93 0.03
94 0.03
95 0.04
96 0.04
97 0.05
98 0.05
99 0.06
100 0.06
101 0.06
102 0.06
103 0.05
104 0.05
105 0.06
106 0.06
107 0.07
108 0.08
109 0.13
110 0.15
111 0.18
112 0.25
113 0.29
114 0.34
115 0.39
116 0.46
117 0.49
118 0.55
119 0.55
120 0.5
121 0.46
122 0.4
123 0.35
124 0.27
125 0.19
126 0.11
127 0.07
128 0.05
129 0.04
130 0.04
131 0.07
132 0.07
133 0.08
134 0.11
135 0.15
136 0.23
137 0.31
138 0.41
139 0.47
140 0.55
141 0.65
142 0.72
143 0.78
144 0.82
145 0.83
146 0.85
147 0.86
148 0.87
149 0.84
150 0.83
151 0.73