Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2L8D0

Protein Details
Accession E2L8D0    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
16-55LIPPRERKPSKRKSEADAEPEPPKPKKPKDLRFPHPKVMLBasic
NLS Segment(s)
PositionSequence
19-52PRERKPSKRKSEADAEPEPPKPKKPKDLRFPHPK
Subcellular Location(s) nucl 13, cyto_nucl 11, mito 7, cyto 7
Family & Domain DBs
KEGG mpr:MPER_02195  -  
Amino Acid Sequences MPAKRDSIKREEIVLLIPPRERKPSKRKSEADAEPEPPKPKKPKDLRFPHPKVMLRLPARPAEPEVFPCCLCISTVKEGLLRVQDPPIGRKDAMEACGNPKVWMAHADCANIVPETWVDEVENPQTGMQELAVFGVDAIVKDRWNLNQCSYDVYLPY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.33
3 0.27
4 0.29
5 0.3
6 0.32
7 0.4
8 0.45
9 0.48
10 0.56
11 0.65
12 0.72
13 0.78
14 0.79
15 0.76
16 0.8
17 0.77
18 0.74
19 0.68
20 0.61
21 0.54
22 0.54
23 0.53
24 0.46
25 0.46
26 0.48
27 0.51
28 0.57
29 0.64
30 0.7
31 0.75
32 0.82
33 0.84
34 0.86
35 0.85
36 0.82
37 0.79
38 0.73
39 0.66
40 0.62
41 0.6
42 0.52
43 0.5
44 0.45
45 0.41
46 0.38
47 0.34
48 0.31
49 0.25
50 0.22
51 0.22
52 0.21
53 0.2
54 0.18
55 0.18
56 0.16
57 0.13
58 0.13
59 0.12
60 0.12
61 0.14
62 0.16
63 0.16
64 0.16
65 0.16
66 0.17
67 0.17
68 0.14
69 0.11
70 0.1
71 0.12
72 0.12
73 0.14
74 0.16
75 0.16
76 0.16
77 0.15
78 0.18
79 0.18
80 0.2
81 0.19
82 0.17
83 0.18
84 0.22
85 0.22
86 0.19
87 0.18
88 0.16
89 0.15
90 0.19
91 0.17
92 0.18
93 0.19
94 0.19
95 0.18
96 0.18
97 0.18
98 0.14
99 0.11
100 0.08
101 0.07
102 0.08
103 0.09
104 0.09
105 0.08
106 0.09
107 0.11
108 0.13
109 0.14
110 0.12
111 0.12
112 0.12
113 0.11
114 0.11
115 0.09
116 0.08
117 0.06
118 0.06
119 0.06
120 0.06
121 0.05
122 0.06
123 0.06
124 0.05
125 0.08
126 0.09
127 0.09
128 0.11
129 0.14
130 0.2
131 0.26
132 0.3
133 0.32
134 0.36
135 0.37
136 0.41
137 0.41