Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4U0V3V5

Protein Details
Accession A0A4U0V3V5    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
33-55HSDSWLGKQRRKQQRRRFVCLWFHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 15, extr 8, mito 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MANVRDPAFWKRFSTAVHLDEEGGYTSRPELKHSDSWLGKQRRKQQRRRFVCLWFWLCFFLFVAGVVAAVIWVLKSGILNNVRLGDGNGTPNQPADPNSNANSRVRRLVEMFVR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.37
3 0.35
4 0.35
5 0.32
6 0.3
7 0.27
8 0.26
9 0.2
10 0.14
11 0.11
12 0.09
13 0.1
14 0.13
15 0.13
16 0.16
17 0.19
18 0.24
19 0.28
20 0.31
21 0.38
22 0.35
23 0.4
24 0.46
25 0.51
26 0.5
27 0.53
28 0.6
29 0.63
30 0.72
31 0.78
32 0.79
33 0.81
34 0.86
35 0.87
36 0.81
37 0.75
38 0.7
39 0.67
40 0.6
41 0.5
42 0.42
43 0.34
44 0.29
45 0.24
46 0.18
47 0.11
48 0.07
49 0.06
50 0.06
51 0.04
52 0.04
53 0.04
54 0.03
55 0.03
56 0.02
57 0.02
58 0.02
59 0.02
60 0.02
61 0.02
62 0.03
63 0.04
64 0.1
65 0.12
66 0.13
67 0.14
68 0.16
69 0.16
70 0.16
71 0.16
72 0.12
73 0.12
74 0.15
75 0.16
76 0.15
77 0.16
78 0.16
79 0.16
80 0.15
81 0.16
82 0.17
83 0.2
84 0.23
85 0.26
86 0.3
87 0.32
88 0.37
89 0.41
90 0.39
91 0.43
92 0.41
93 0.42
94 0.4