Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2M4L3

Protein Details
Accession E2M4L3   
Localization Confidence Medium
Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MSSKRGRKRNDNLPPHRARDVBasic
NLS Segment(s)
PositionSequence
5-10RGRKRN
15-17PHR
Subcellular Location(s) nucl 18, cyto_nucl 13, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR046347  bZIP_sf  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
KEGG mpr:MPER_15270  -  
Amino Acid Sequences MSSKRGRKRNDNLPPHRARDVQRALRARRAAHLQALEQRVAELEEENNCLRQALNLPGANRPPLGKGPTGKDRPKPAEPSSVSQHGSLPLPLPLPSRDSTDSPPSTRMSSHSPPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.8
3 0.76
4 0.7
5 0.64
6 0.63
7 0.64
8 0.62
9 0.63
10 0.66
11 0.65
12 0.67
13 0.66
14 0.57
15 0.52
16 0.5
17 0.44
18 0.4
19 0.38
20 0.33
21 0.35
22 0.36
23 0.31
24 0.25
25 0.22
26 0.17
27 0.16
28 0.14
29 0.08
30 0.07
31 0.08
32 0.1
33 0.11
34 0.11
35 0.11
36 0.1
37 0.1
38 0.09
39 0.1
40 0.11
41 0.15
42 0.16
43 0.17
44 0.19
45 0.2
46 0.2
47 0.18
48 0.15
49 0.13
50 0.14
51 0.16
52 0.16
53 0.18
54 0.23
55 0.31
56 0.39
57 0.42
58 0.45
59 0.51
60 0.55
61 0.58
62 0.59
63 0.53
64 0.55
65 0.53
66 0.52
67 0.49
68 0.48
69 0.43
70 0.37
71 0.35
72 0.27
73 0.26
74 0.21
75 0.17
76 0.13
77 0.13
78 0.13
79 0.15
80 0.14
81 0.18
82 0.18
83 0.23
84 0.25
85 0.28
86 0.32
87 0.39
88 0.42
89 0.4
90 0.42
91 0.39
92 0.38
93 0.35
94 0.34
95 0.33