Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4U0V029

Protein Details
Accession A0A4U0V029    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MAPAAAGKKQKKKWSKGKVKDKANHAVIHydrophilic
NLS Segment(s)
PositionSequence
7-22GKKQKKKWSKGKVKDK
Subcellular Location(s) cyto 21.5, cyto_nucl 12, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPAAAGKKQKKKWSKGKVKDKANHAVILDKATGEKLAKDVQSYRLITVAVLVDRLKINGSLARTALADLEEKGTIKKVVAHSSGNIYSEYTHVRDWLGWIFEAGMLTLNVARAVGGGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.88
3 0.89
4 0.92
5 0.92
6 0.92
7 0.89
8 0.85
9 0.84
10 0.75
11 0.68
12 0.57
13 0.51
14 0.41
15 0.36
16 0.28
17 0.19
18 0.16
19 0.13
20 0.14
21 0.1
22 0.1
23 0.1
24 0.13
25 0.14
26 0.15
27 0.17
28 0.2
29 0.25
30 0.26
31 0.24
32 0.21
33 0.21
34 0.18
35 0.17
36 0.14
37 0.07
38 0.08
39 0.07
40 0.07
41 0.07
42 0.08
43 0.07
44 0.06
45 0.07
46 0.08
47 0.09
48 0.09
49 0.09
50 0.09
51 0.09
52 0.09
53 0.09
54 0.07
55 0.07
56 0.06
57 0.07
58 0.07
59 0.07
60 0.08
61 0.09
62 0.09
63 0.08
64 0.13
65 0.14
66 0.19
67 0.22
68 0.23
69 0.22
70 0.27
71 0.28
72 0.24
73 0.21
74 0.17
75 0.15
76 0.15
77 0.17
78 0.14
79 0.13
80 0.13
81 0.13
82 0.13
83 0.15
84 0.17
85 0.16
86 0.14
87 0.13
88 0.13
89 0.13
90 0.13
91 0.11
92 0.09
93 0.07
94 0.07
95 0.08
96 0.08
97 0.07
98 0.07
99 0.07