Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4U0UFU1

Protein Details
Accession A0A4U0UFU1    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
96-126GQASKIEKPSRQQRKQRKNRMKEFRGTAKVKHydrophilic
NLS Segment(s)
PositionSequence
101-134IEKPSRQQRKQRKNRMKEFRGTAKVKGAAKKKDK
Subcellular Location(s) mito 16, nucl 6.5, cyto_nucl 6, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MSEGQVTLRTRKFIRNPLLGRKQMVVDVLHPNRPNVAKDELRSKLSELYKSSKDQVSVFGFKTQYGGGKSTGFALVYDSPEAMKKFEPHYRLVRYGQASKIEKPSRQQRKQRKNRMKEFRGTAKVKGAAKKKDK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.62
3 0.65
4 0.71
5 0.78
6 0.72
7 0.66
8 0.59
9 0.51
10 0.42
11 0.38
12 0.29
13 0.22
14 0.29
15 0.29
16 0.33
17 0.32
18 0.31
19 0.33
20 0.34
21 0.32
22 0.26
23 0.3
24 0.28
25 0.29
26 0.37
27 0.36
28 0.36
29 0.35
30 0.32
31 0.32
32 0.32
33 0.33
34 0.29
35 0.31
36 0.32
37 0.34
38 0.36
39 0.31
40 0.29
41 0.26
42 0.27
43 0.26
44 0.26
45 0.24
46 0.24
47 0.23
48 0.21
49 0.22
50 0.17
51 0.15
52 0.13
53 0.14
54 0.12
55 0.12
56 0.12
57 0.12
58 0.12
59 0.09
60 0.08
61 0.09
62 0.09
63 0.09
64 0.09
65 0.08
66 0.08
67 0.11
68 0.11
69 0.1
70 0.11
71 0.13
72 0.17
73 0.22
74 0.25
75 0.28
76 0.35
77 0.38
78 0.41
79 0.41
80 0.42
81 0.41
82 0.42
83 0.41
84 0.42
85 0.4
86 0.39
87 0.47
88 0.46
89 0.45
90 0.49
91 0.57
92 0.6
93 0.67
94 0.74
95 0.76
96 0.82
97 0.9
98 0.93
99 0.94
100 0.93
101 0.94
102 0.95
103 0.92
104 0.89
105 0.87
106 0.85
107 0.84
108 0.76
109 0.69
110 0.66
111 0.64
112 0.61
113 0.6
114 0.59