Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4U0VDJ7

Protein Details
Accession A0A4U0VDJ7    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
45-65AKDPKRWKKIYCLSRRPPLVAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10, cyto 8.5, cyto_nucl 5.5, pero 5, cysk 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001509  Epimerase_deHydtase  
IPR036291  NAD(P)-bd_dom_sf  
Pfam View protein in Pfam  
PF01370  Epimerase  
CDD cd08948  5beta-POR_like_SDR_a  
Amino Acid Sequences MSVQQVQSAGIYHGLPVYPSEHSGLTAIITGANGISGAYMLRVLAKDPKRWKKIYCLSRRPPLVAGGLPAHAEHIPLDFLKDPKEIAGVLKEHNVTADHVFFFSYIQPPPRAGSAGIWSDAEELVRVNSLLISNFLEALKVASITPKRFMLQTGAKNYGVHLGPTKVPQEETDPRVTLEPNFYYAQEDLLTKFCAETGTAWNICMPGPILGAVPDAAMNAAFPLAVYCAVSRKLGQPLEFPGDAASWQMNQSMSSSMMNAYMEEWAVLLGPPDQKYNTCDSSAFAWESAWPRVAGWYGVESRGPRDGKEYVESETGFNPRGYGGKGVTRRKFRLADWAKREEVKKAWAELAEEHGLTQRELVDVDRVFGFTDGTLCRPAPLSFSMDKSRKLGWHGFVDSTESLLEVFKDLAHIKMIPPVPQAKVSFN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.12
4 0.13
5 0.13
6 0.15
7 0.16
8 0.15
9 0.16
10 0.16
11 0.15
12 0.12
13 0.12
14 0.1
15 0.09
16 0.08
17 0.07
18 0.06
19 0.06
20 0.05
21 0.04
22 0.04
23 0.04
24 0.04
25 0.04
26 0.04
27 0.04
28 0.07
29 0.07
30 0.1
31 0.19
32 0.24
33 0.33
34 0.44
35 0.54
36 0.61
37 0.66
38 0.69
39 0.71
40 0.76
41 0.78
42 0.78
43 0.79
44 0.79
45 0.82
46 0.82
47 0.74
48 0.66
49 0.58
50 0.51
51 0.41
52 0.35
53 0.28
54 0.24
55 0.21
56 0.19
57 0.17
58 0.13
59 0.13
60 0.1
61 0.09
62 0.1
63 0.09
64 0.12
65 0.13
66 0.14
67 0.17
68 0.17
69 0.16
70 0.16
71 0.17
72 0.15
73 0.14
74 0.18
75 0.17
76 0.17
77 0.22
78 0.21
79 0.2
80 0.21
81 0.2
82 0.17
83 0.17
84 0.18
85 0.14
86 0.14
87 0.14
88 0.13
89 0.13
90 0.13
91 0.13
92 0.14
93 0.18
94 0.19
95 0.2
96 0.21
97 0.22
98 0.21
99 0.18
100 0.17
101 0.18
102 0.19
103 0.18
104 0.17
105 0.16
106 0.15
107 0.15
108 0.13
109 0.08
110 0.07
111 0.06
112 0.06
113 0.06
114 0.05
115 0.06
116 0.06
117 0.06
118 0.07
119 0.08
120 0.08
121 0.09
122 0.09
123 0.08
124 0.08
125 0.08
126 0.07
127 0.06
128 0.06
129 0.11
130 0.15
131 0.16
132 0.19
133 0.2
134 0.2
135 0.21
136 0.22
137 0.23
138 0.27
139 0.32
140 0.34
141 0.37
142 0.37
143 0.36
144 0.35
145 0.33
146 0.26
147 0.2
148 0.17
149 0.15
150 0.15
151 0.18
152 0.19
153 0.15
154 0.15
155 0.15
156 0.21
157 0.24
158 0.27
159 0.28
160 0.27
161 0.26
162 0.27
163 0.27
164 0.21
165 0.2
166 0.16
167 0.16
168 0.16
169 0.16
170 0.16
171 0.16
172 0.15
173 0.12
174 0.12
175 0.1
176 0.11
177 0.11
178 0.09
179 0.09
180 0.08
181 0.08
182 0.07
183 0.08
184 0.1
185 0.13
186 0.14
187 0.14
188 0.14
189 0.14
190 0.13
191 0.12
192 0.09
193 0.05
194 0.05
195 0.06
196 0.05
197 0.05
198 0.05
199 0.05
200 0.04
201 0.04
202 0.04
203 0.03
204 0.03
205 0.03
206 0.03
207 0.02
208 0.02
209 0.02
210 0.02
211 0.03
212 0.03
213 0.04
214 0.04
215 0.06
216 0.07
217 0.08
218 0.09
219 0.11
220 0.17
221 0.18
222 0.19
223 0.19
224 0.21
225 0.25
226 0.24
227 0.21
228 0.16
229 0.14
230 0.13
231 0.12
232 0.09
233 0.06
234 0.06
235 0.07
236 0.07
237 0.07
238 0.08
239 0.08
240 0.09
241 0.09
242 0.09
243 0.08
244 0.09
245 0.09
246 0.08
247 0.07
248 0.06
249 0.06
250 0.05
251 0.05
252 0.04
253 0.04
254 0.04
255 0.04
256 0.06
257 0.09
258 0.1
259 0.11
260 0.12
261 0.13
262 0.16
263 0.22
264 0.22
265 0.2
266 0.2
267 0.2
268 0.21
269 0.23
270 0.2
271 0.15
272 0.13
273 0.15
274 0.17
275 0.17
276 0.16
277 0.13
278 0.13
279 0.14
280 0.14
281 0.12
282 0.1
283 0.12
284 0.12
285 0.13
286 0.15
287 0.14
288 0.15
289 0.22
290 0.22
291 0.19
292 0.22
293 0.24
294 0.25
295 0.28
296 0.28
297 0.23
298 0.26
299 0.26
300 0.23
301 0.23
302 0.22
303 0.2
304 0.18
305 0.16
306 0.14
307 0.15
308 0.15
309 0.15
310 0.15
311 0.21
312 0.29
313 0.39
314 0.45
315 0.52
316 0.54
317 0.59
318 0.6
319 0.53
320 0.57
321 0.57
322 0.6
323 0.59
324 0.62
325 0.58
326 0.6
327 0.6
328 0.55
329 0.49
330 0.46
331 0.42
332 0.38
333 0.38
334 0.34
335 0.34
336 0.3
337 0.31
338 0.26
339 0.22
340 0.2
341 0.2
342 0.2
343 0.18
344 0.18
345 0.13
346 0.11
347 0.12
348 0.13
349 0.15
350 0.14
351 0.16
352 0.15
353 0.15
354 0.15
355 0.15
356 0.14
357 0.08
358 0.12
359 0.11
360 0.13
361 0.16
362 0.15
363 0.16
364 0.18
365 0.18
366 0.18
367 0.19
368 0.23
369 0.23
370 0.28
371 0.37
372 0.39
373 0.42
374 0.42
375 0.44
376 0.41
377 0.45
378 0.47
379 0.43
380 0.47
381 0.47
382 0.45
383 0.41
384 0.42
385 0.36
386 0.29
387 0.24
388 0.16
389 0.13
390 0.12
391 0.12
392 0.08
393 0.08
394 0.07
395 0.11
396 0.12
397 0.13
398 0.15
399 0.16
400 0.16
401 0.23
402 0.26
403 0.25
404 0.3
405 0.34
406 0.34
407 0.39