Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4U0VFH8

Protein Details
Accession A0A4U0VFH8    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
38-57GKVSHKKKAATPRKRTVAKSBasic
NLS Segment(s)
PositionSequence
38-52GKVSHKKKAATPRKR
74-93QKKKAKGTPGPVRKRKAPVS
Subcellular Location(s) cyto 14, cyto_nucl 13.5, nucl 11
Family & Domain DBs
Amino Acid Sequences MDITPHFTAANAPPAEAGVGSWGAASPSPVEEPTPVRGKVSHKKKAATPRKRTVAKSSEDDEGGEDSEGGESPQKKKAKGTPGPVRKRKAPVSKLANARVIGRSYDECSEEDKILLDLRDAGKGWTEIRAEWEKLTGDKTGHSTLPNRYARLKSNFVVIREEDNQILLEAKIDVEAAFEKEKWGLIAAAMEKKGADSYGGEVLHKQYKKLMLEANFAPPPGVKSKDFESEEDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.21
3 0.17
4 0.14
5 0.07
6 0.07
7 0.07
8 0.07
9 0.07
10 0.07
11 0.07
12 0.08
13 0.07
14 0.08
15 0.1
16 0.11
17 0.12
18 0.14
19 0.17
20 0.22
21 0.27
22 0.25
23 0.25
24 0.29
25 0.36
26 0.44
27 0.51
28 0.55
29 0.55
30 0.58
31 0.64
32 0.72
33 0.74
34 0.75
35 0.75
36 0.76
37 0.8
38 0.82
39 0.79
40 0.78
41 0.74
42 0.68
43 0.63
44 0.56
45 0.49
46 0.43
47 0.39
48 0.3
49 0.24
50 0.19
51 0.13
52 0.1
53 0.07
54 0.07
55 0.07
56 0.06
57 0.09
58 0.11
59 0.14
60 0.22
61 0.25
62 0.26
63 0.31
64 0.38
65 0.45
66 0.5
67 0.57
68 0.6
69 0.67
70 0.77
71 0.8
72 0.77
73 0.72
74 0.72
75 0.71
76 0.71
77 0.65
78 0.64
79 0.64
80 0.66
81 0.66
82 0.63
83 0.57
84 0.48
85 0.44
86 0.37
87 0.3
88 0.23
89 0.19
90 0.16
91 0.15
92 0.15
93 0.15
94 0.14
95 0.15
96 0.16
97 0.14
98 0.13
99 0.11
100 0.1
101 0.1
102 0.09
103 0.07
104 0.08
105 0.08
106 0.09
107 0.09
108 0.08
109 0.08
110 0.09
111 0.09
112 0.1
113 0.1
114 0.09
115 0.14
116 0.17
117 0.17
118 0.17
119 0.18
120 0.15
121 0.15
122 0.17
123 0.13
124 0.11
125 0.11
126 0.14
127 0.15
128 0.16
129 0.17
130 0.19
131 0.21
132 0.3
133 0.32
134 0.3
135 0.33
136 0.35
137 0.4
138 0.43
139 0.44
140 0.35
141 0.4
142 0.41
143 0.38
144 0.39
145 0.33
146 0.31
147 0.29
148 0.3
149 0.22
150 0.19
151 0.18
152 0.14
153 0.14
154 0.09
155 0.08
156 0.06
157 0.06
158 0.06
159 0.06
160 0.05
161 0.05
162 0.07
163 0.08
164 0.1
165 0.1
166 0.1
167 0.11
168 0.11
169 0.1
170 0.11
171 0.09
172 0.07
173 0.11
174 0.13
175 0.17
176 0.16
177 0.16
178 0.15
179 0.15
180 0.15
181 0.13
182 0.1
183 0.07
184 0.1
185 0.15
186 0.16
187 0.15
188 0.16
189 0.2
190 0.28
191 0.27
192 0.26
193 0.26
194 0.32
195 0.34
196 0.38
197 0.41
198 0.36
199 0.41
200 0.42
201 0.45
202 0.39
203 0.37
204 0.32
205 0.26
206 0.26
207 0.26
208 0.29
209 0.23
210 0.26
211 0.31
212 0.4
213 0.42