FuNGI

A0A4U0VMJ2

Protein Details

Accession

A0A4U0VMJ2

Localization Confidence

Medium

Confidence Score

14.2

NoLS Segment(s)

Position	Sequence	Protein Nature
35-81	SADAGFKRRKMAHKREDTPPAITLTKPTPAKADKKRKRQLEPVAEDE	Hydrophilic

NLS Segment(s)

Position	Sequence
40-55	FKRRKMAHKREDTPPA
58-72	LTKPTPAKADKKRKR

Subcellular Location(s)

nucl 16.5, cyto_nucl 12, cyto 6.5, mito 4

Family & Domain DBs

InterPro	View protein in InterPro IPR032054 Cdt1_C IPR038090 Cdt1_C_WH_dom_sf
Gene Ontology	GO:0007049 P:cell cycle
Pfam	View protein in Pfam PF16679 CDT1_C

Amino Acid Sequences

MAIARKRKQLDVDEAATPGKQTSMKGFAAVSKERSADAGFKRRKMAHKREDTPPAITLTKPTPAKADKKRKRQLEPVAEDEQEGDNPEKRIFRQSTENVYATSPRTKRCKTALPPSPVGTPSKSAAALFDKLKLGGASISFSLGGRPVGYETPPDTPEAESNQESLQWPSELQDLCHLQAAFLSALSMYYAHNGTTSPVKVGNLLPMITKNWKKRAVSLEDLRRLLAVQHRDQPEFLLEDAGRAGVCLSRSQSRGRALKRAGSYIDEDDTNGRFEQALEASWKRWPMAEEAQNSSAPAFVAQLPLAQIAVSASAEKASPLFARGQQRLADLKSAQASASRIPDTLPPAINIDEKPSQAVQSRDTSLLDRVLARQALASSLPAGPTKQQMERKAALHRVEDIARVLGLLVGAKPRVSLSMQAMVQQLQQSLRNPISREEVEQCLELMAAEVMPGFVSLFVNGSVRGVVVRRDGRLDAADVRMMVEKLGG

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.49
2	0.45
3	0.38
4	0.31
5	0.21
6	0.17
7	0.15
8	0.15
9	0.2
10	0.26
11	0.26
12	0.27
13	0.27
14	0.28
15	0.33
16	0.36
17	0.34
18	0.31
19	0.31
20	0.3
21	0.31
22	0.29
23	0.3
24	0.34
25	0.41
26	0.44
27	0.47
28	0.55
29	0.6
30	0.68
31	0.71
32	0.74
33	0.74
34	0.78
35	0.8
36	0.82
37	0.84
38	0.78
39	0.7
40	0.61
41	0.55
42	0.46
43	0.39
44	0.35
45	0.28
46	0.32
47	0.3
48	0.29
49	0.32
50	0.38
51	0.48
52	0.55
53	0.63
54	0.66
55	0.75
56	0.84
57	0.86
58	0.87
59	0.87
60	0.87
61	0.87
62	0.83
63	0.78
64	0.73
65	0.64
66	0.55
67	0.47
68	0.37
69	0.26
70	0.22
71	0.18
72	0.17
73	0.19
74	0.21
75	0.23
76	0.23
77	0.32
78	0.32
79	0.34
80	0.4
81	0.44
82	0.5
83	0.53
84	0.52
85	0.43
86	0.42
87	0.41
88	0.35
89	0.38
90	0.33
91	0.34
92	0.42
93	0.44
94	0.49
95	0.53
96	0.6
97	0.59
98	0.67
99	0.69
100	0.68
101	0.69
102	0.64
103	0.61
104	0.53
105	0.48
106	0.39
107	0.32
108	0.26
109	0.24
110	0.22
111	0.18
112	0.19
113	0.2
114	0.21
115	0.2
116	0.21
117	0.19
118	0.19
119	0.2
120	0.17
121	0.13
122	0.11
123	0.1
124	0.09
125	0.08
126	0.09
127	0.08
128	0.08
129	0.08
130	0.08
131	0.08
132	0.06
133	0.07
134	0.08
135	0.09
136	0.1
137	0.11
138	0.13
139	0.16
140	0.16
141	0.17
142	0.16
143	0.16
144	0.18
145	0.19
146	0.21
147	0.18
148	0.18
149	0.17
150	0.18
151	0.18
152	0.17
153	0.15
154	0.11
155	0.11
156	0.11
157	0.16
158	0.14
159	0.14
160	0.18
161	0.18
162	0.18
163	0.21
164	0.2
165	0.15
166	0.15
167	0.16
168	0.11
169	0.09
170	0.09
171	0.05
172	0.05
173	0.05
174	0.05
175	0.04
176	0.05
177	0.06
178	0.06
179	0.06
180	0.06
181	0.07
182	0.11
183	0.11
184	0.1
185	0.11
186	0.11
187	0.13
188	0.13
189	0.15
190	0.13
191	0.13
192	0.12
193	0.12
194	0.14
195	0.19
196	0.25
197	0.27
198	0.34
199	0.39
200	0.4
201	0.45
202	0.51
203	0.5
204	0.51
205	0.53
206	0.55
207	0.53
208	0.53
209	0.47
210	0.39
211	0.33
212	0.27
213	0.24
214	0.21
215	0.19
216	0.25
217	0.28
218	0.28
219	0.28
220	0.27
221	0.23
222	0.19
223	0.16
224	0.12
225	0.09
226	0.09
227	0.09
228	0.08
229	0.07
230	0.05
231	0.06
232	0.04
233	0.05
234	0.06
235	0.08
236	0.11
237	0.13
238	0.16
239	0.2
240	0.26
241	0.32
242	0.34
243	0.39
244	0.38
245	0.42
246	0.41
247	0.39
248	0.33
249	0.28
250	0.28
251	0.21
252	0.21
253	0.15
254	0.14
255	0.13
256	0.13
257	0.12
258	0.1
259	0.09
260	0.08
261	0.08
262	0.09
263	0.08
264	0.08
265	0.11
266	0.12
267	0.12
268	0.14
269	0.15
270	0.13
271	0.14
272	0.14
273	0.16
274	0.23
275	0.28
276	0.29
277	0.32
278	0.34
279	0.33
280	0.32
281	0.26
282	0.19
283	0.13
284	0.1
285	0.07
286	0.06
287	0.07
288	0.07
289	0.07
290	0.07
291	0.07
292	0.07
293	0.06
294	0.05
295	0.04
296	0.05
297	0.04
298	0.04
299	0.04
300	0.05
301	0.05
302	0.05
303	0.05
304	0.06
305	0.06
306	0.07
307	0.1
308	0.15
309	0.22
310	0.24
311	0.27
312	0.26
313	0.29
314	0.31
315	0.3
316	0.28
317	0.21
318	0.22
319	0.21
320	0.2
321	0.17
322	0.16
323	0.16
324	0.15
325	0.18
326	0.17
327	0.15
328	0.16
329	0.19
330	0.2
331	0.22
332	0.2
333	0.18
334	0.19
335	0.2
336	0.22
337	0.19
338	0.21
339	0.2
340	0.19
341	0.2
342	0.19
343	0.2
344	0.22
345	0.24
346	0.22
347	0.24
348	0.26
349	0.25
350	0.26
351	0.25
352	0.23
353	0.22
354	0.2
355	0.16
356	0.16
357	0.18
358	0.17
359	0.16
360	0.15
361	0.13
362	0.13
363	0.13
364	0.12
365	0.09
366	0.1
367	0.11
368	0.11
369	0.12
370	0.12
371	0.18
372	0.21
373	0.27
374	0.34
375	0.38
376	0.45
377	0.48
378	0.5
379	0.52
380	0.55
381	0.51
382	0.45
383	0.43
384	0.39
385	0.36
386	0.34
387	0.28
388	0.21
389	0.17
390	0.15
391	0.13
392	0.09
393	0.08
394	0.07
395	0.07
396	0.08
397	0.09
398	0.09
399	0.1
400	0.1
401	0.12
402	0.13
403	0.16
404	0.18
405	0.24
406	0.24
407	0.27
408	0.28
409	0.27
410	0.27
411	0.25
412	0.23
413	0.19
414	0.23
415	0.22
416	0.27
417	0.32
418	0.34
419	0.34
420	0.35
421	0.4
422	0.38
423	0.4
424	0.38
425	0.37
426	0.35
427	0.34
428	0.3
429	0.23
430	0.21
431	0.16
432	0.12
433	0.08
434	0.06
435	0.05
436	0.05
437	0.05
438	0.05
439	0.05
440	0.04
441	0.05
442	0.05
443	0.06
444	0.07
445	0.08
446	0.09
447	0.09
448	0.09
449	0.09
450	0.08
451	0.1
452	0.11
453	0.13
454	0.2
455	0.24
456	0.26
457	0.3
458	0.3
459	0.32
460	0.32
461	0.33
462	0.28
463	0.27
464	0.26
465	0.23
466	0.23
467	0.23
468	0.21

A0A4U0VMJ2

3D AlphaFold-predicted Structure Viewer