Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4U0VJU4

Protein Details
Accession A0A4U0VJU4    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
33-58QNLLEQHKQNLKRRRRQRNEAIKVAHHydrophilic
NLS Segment(s)
PositionSequence
44-49KRRRRQ
Subcellular Location(s) nucl 22, cyto_nucl 14.5, cyto 5
Family & Domain DBs
Amino Acid Sequences MSRDDDPSLSEDMASHETQPSQETHTIDTTSVQNLLEQHKQNLKRRRRQRNEAIKVAHTARMEGLGKAYERAKTQYQETVRATQRPKLERLLHLIKKKREVKVSIDDCVSQKEAAFMGTVDKIMLAADARSAAME
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.17
3 0.16
4 0.16
5 0.17
6 0.18
7 0.16
8 0.17
9 0.21
10 0.21
11 0.22
12 0.24
13 0.24
14 0.22
15 0.23
16 0.19
17 0.17
18 0.16
19 0.13
20 0.13
21 0.14
22 0.18
23 0.23
24 0.23
25 0.27
26 0.33
27 0.41
28 0.49
29 0.56
30 0.62
31 0.66
32 0.75
33 0.82
34 0.84
35 0.87
36 0.88
37 0.9
38 0.88
39 0.85
40 0.77
41 0.67
42 0.6
43 0.52
44 0.44
45 0.33
46 0.25
47 0.18
48 0.18
49 0.17
50 0.13
51 0.12
52 0.1
53 0.1
54 0.11
55 0.12
56 0.11
57 0.11
58 0.14
59 0.17
60 0.17
61 0.19
62 0.24
63 0.25
64 0.29
65 0.31
66 0.34
67 0.34
68 0.38
69 0.38
70 0.37
71 0.42
72 0.39
73 0.4
74 0.41
75 0.43
76 0.39
77 0.45
78 0.5
79 0.5
80 0.55
81 0.6
82 0.57
83 0.63
84 0.67
85 0.65
86 0.63
87 0.6
88 0.59
89 0.61
90 0.6
91 0.53
92 0.48
93 0.44
94 0.37
95 0.37
96 0.32
97 0.21
98 0.18
99 0.16
100 0.15
101 0.13
102 0.12
103 0.09
104 0.1
105 0.1
106 0.1
107 0.09
108 0.08
109 0.08
110 0.07
111 0.08
112 0.06
113 0.06
114 0.06
115 0.07