Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4U0V386

Protein Details
Accession A0A4U0V386    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
120-154EVCKVGMRGLRRRDRSKRKKKEKGKKKGLAEGAKPBasic
NLS Segment(s)
PositionSequence
127-154RGLRRRDRSKRKKKEKGKKKGLAEGAKP
Subcellular Location(s) nucl 11.5, cyto_nucl 10.5, mito 8, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003210  Signal_recog_particle_SRP14  
IPR009018  Signal_recog_particle_SRP9/14  
Gene Ontology GO:0005786  C:signal recognition particle, endoplasmic reticulum targeting  
GO:0008312  F:7S RNA binding  
GO:0030942  F:endoplasmic reticulum signal peptide binding  
GO:0006614  P:SRP-dependent cotranslational protein targeting to membrane  
Pfam View protein in Pfam  
PF02290  SRP14  
Amino Acid Sequences MAREHLSNDDFFTQLVTLIETTHQKGHGSVYLTQKRLTYGTSDPSPPTAKVPDDPLWDLHPPNPLPLIVRATDGKSHKLAKEEGADATGGIGRTKNGEKVKLSTVVQPESIEAFFTRYAEVCKVGMRGLRRRDRSKRKKKEKGKKKGLAEGAKP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.1
4 0.08
5 0.09
6 0.11
7 0.13
8 0.16
9 0.17
10 0.18
11 0.17
12 0.18
13 0.2
14 0.21
15 0.22
16 0.25
17 0.33
18 0.39
19 0.4
20 0.4
21 0.38
22 0.36
23 0.34
24 0.29
25 0.23
26 0.19
27 0.23
28 0.25
29 0.26
30 0.25
31 0.27
32 0.29
33 0.25
34 0.25
35 0.22
36 0.21
37 0.2
38 0.26
39 0.26
40 0.27
41 0.28
42 0.26
43 0.26
44 0.26
45 0.25
46 0.21
47 0.23
48 0.19
49 0.19
50 0.18
51 0.15
52 0.15
53 0.16
54 0.17
55 0.12
56 0.13
57 0.13
58 0.13
59 0.18
60 0.18
61 0.19
62 0.19
63 0.22
64 0.21
65 0.23
66 0.23
67 0.2
68 0.21
69 0.2
70 0.17
71 0.15
72 0.14
73 0.11
74 0.1
75 0.09
76 0.06
77 0.06
78 0.06
79 0.05
80 0.08
81 0.1
82 0.16
83 0.17
84 0.21
85 0.23
86 0.26
87 0.29
88 0.3
89 0.3
90 0.29
91 0.3
92 0.28
93 0.27
94 0.24
95 0.21
96 0.19
97 0.18
98 0.14
99 0.1
100 0.11
101 0.1
102 0.1
103 0.1
104 0.09
105 0.12
106 0.12
107 0.14
108 0.12
109 0.14
110 0.14
111 0.16
112 0.19
113 0.23
114 0.3
115 0.39
116 0.48
117 0.55
118 0.65
119 0.74
120 0.82
121 0.86
122 0.89
123 0.91
124 0.93
125 0.95
126 0.96
127 0.96
128 0.96
129 0.96
130 0.96
131 0.94
132 0.91
133 0.9
134 0.88